


| Basic Information | |
|---|---|
| Family ID | F096007 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFLVVALAWEVT |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.95 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01970 | TctA | 17.14 |
| PF05145 | AbrB | 17.14 |
| PF01161 | PBP | 1.90 |
| PF06823 | DUF1236 | 1.90 |
| PF14833 | NAD_binding_11 | 1.90 |
| PF03446 | NAD_binding_2 | 1.90 |
| PF02738 | MoCoBD_1 | 1.90 |
| PF03401 | TctC | 0.95 |
| PF13417 | GST_N_3 | 0.95 |
| PF07331 | TctB | 0.95 |
| PF13409 | GST_N_2 | 0.95 |
| PF03706 | LPG_synthase_TM | 0.95 |
| PF01042 | Ribonuc_L-PSP | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 17.14 |
| COG3180 | Uncharacterized membrane protein AbrB, regulator of aidB expression | General function prediction only [R] | 17.14 |
| COG3333 | TctA family transporter | General function prediction only [R] | 17.14 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.90 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.95 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.48 % |
| Unclassified | root | N/A | 29.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573005|GZGK9D401ARZRF | Not Available | 511 | Open in IMG/M |
| 3300000891|JGI10214J12806_10883463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300002568|C688J35102_117983060 | Not Available | 520 | Open in IMG/M |
| 3300004157|Ga0062590_102368172 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300004281|Ga0066397_10088224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300004633|Ga0066395_10736629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300005093|Ga0062594_103413462 | Not Available | 500 | Open in IMG/M |
| 3300005166|Ga0066674_10233538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
| 3300005329|Ga0070683_100457810 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300005330|Ga0070690_100037127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3069 | Open in IMG/M |
| 3300005332|Ga0066388_107732790 | Not Available | 538 | Open in IMG/M |
| 3300005347|Ga0070668_101891582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300005355|Ga0070671_100292104 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300005364|Ga0070673_102406687 | Not Available | 501 | Open in IMG/M |
| 3300005455|Ga0070663_100884576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300005564|Ga0070664_101737640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300005713|Ga0066905_100009175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4571 | Open in IMG/M |
| 3300005713|Ga0066905_101888090 | Not Available | 552 | Open in IMG/M |
| 3300005764|Ga0066903_100057111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4832 | Open in IMG/M |
| 3300006038|Ga0075365_10692478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300006041|Ga0075023_100520270 | Not Available | 539 | Open in IMG/M |
| 3300006051|Ga0075364_10637959 | Not Available | 728 | Open in IMG/M |
| 3300006051|Ga0075364_10685111 | Not Available | 700 | Open in IMG/M |
| 3300006172|Ga0075018_10059026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1618 | Open in IMG/M |
| 3300006914|Ga0075436_101101454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300007076|Ga0075435_101059212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300009098|Ga0105245_11662921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300009147|Ga0114129_13523154 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009148|Ga0105243_11732282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300009162|Ga0075423_10543574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1223 | Open in IMG/M |
| 3300009792|Ga0126374_11473544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300010048|Ga0126373_11517651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300010048|Ga0126373_12139104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300010358|Ga0126370_11245600 | Not Available | 694 | Open in IMG/M |
| 3300010358|Ga0126370_12259305 | Not Available | 537 | Open in IMG/M |
| 3300010360|Ga0126372_11127127 | Not Available | 804 | Open in IMG/M |
| 3300010360|Ga0126372_11633195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300010361|Ga0126378_12154746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300010361|Ga0126378_12530177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300010362|Ga0126377_11563793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300010371|Ga0134125_10230208 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300010376|Ga0126381_103326334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300011270|Ga0137391_10088283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2679 | Open in IMG/M |
| 3300012096|Ga0137389_11032218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300012358|Ga0137368_10196797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300012359|Ga0137385_10412026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1151 | Open in IMG/M |
| 3300012360|Ga0137375_10426753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1150 | Open in IMG/M |
| 3300012361|Ga0137360_10350644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300012930|Ga0137407_11745066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300012955|Ga0164298_10578314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300012961|Ga0164302_11907275 | Not Available | 505 | Open in IMG/M |
| 3300012971|Ga0126369_10905628 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012985|Ga0164308_12182316 | Not Available | 516 | Open in IMG/M |
| 3300013296|Ga0157374_10176022 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300013308|Ga0157375_13504622 | Not Available | 522 | Open in IMG/M |
| 3300014326|Ga0157380_11699431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300015374|Ga0132255_101554331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1002 | Open in IMG/M |
| 3300015374|Ga0132255_103217549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_44_11 | 696 | Open in IMG/M |
| 3300016387|Ga0182040_10107860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1905 | Open in IMG/M |
| 3300016387|Ga0182040_10532589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300016445|Ga0182038_10144527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1806 | Open in IMG/M |
| 3300018081|Ga0184625_10254400 | Not Available | 920 | Open in IMG/M |
| 3300018468|Ga0066662_10185746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300018469|Ga0190270_13442573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300019889|Ga0193743_1161891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300020002|Ga0193730_1173370 | Not Available | 550 | Open in IMG/M |
| 3300021475|Ga0210392_10061408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2354 | Open in IMG/M |
| 3300021560|Ga0126371_13697766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300025924|Ga0207694_11881931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 502 | Open in IMG/M |
| 3300025972|Ga0207668_11735142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300026088|Ga0207641_12265783 | Not Available | 543 | Open in IMG/M |
| 3300026542|Ga0209805_1414359 | Not Available | 521 | Open in IMG/M |
| 3300026815|Ga0207442_102731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300026870|Ga0208762_1001266 | Not Available | 868 | Open in IMG/M |
| 3300027812|Ga0209656_10360014 | Not Available | 660 | Open in IMG/M |
| 3300027874|Ga0209465_10452308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300028596|Ga0247821_11266623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 503 | Open in IMG/M |
| 3300028718|Ga0307307_10275237 | Not Available | 540 | Open in IMG/M |
| 3300028799|Ga0307284_10361556 | Not Available | 588 | Open in IMG/M |
| 3300028884|Ga0307308_10647611 | Not Available | 506 | Open in IMG/M |
| 3300031152|Ga0307501_10090480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300031545|Ga0318541_10222852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300031546|Ga0318538_10073767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1719 | Open in IMG/M |
| 3300031561|Ga0318528_10432341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300031564|Ga0318573_10303949 | Not Available | 854 | Open in IMG/M |
| 3300031573|Ga0310915_10182888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1460 | Open in IMG/M |
| 3300031668|Ga0318542_10642955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031751|Ga0318494_10533533 | Not Available | 685 | Open in IMG/M |
| 3300031779|Ga0318566_10000917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8706 | Open in IMG/M |
| 3300031833|Ga0310917_10228152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1250 | Open in IMG/M |
| 3300031835|Ga0318517_10129298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1121 | Open in IMG/M |
| 3300031879|Ga0306919_10065479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2457 | Open in IMG/M |
| 3300031879|Ga0306919_11449387 | Not Available | 517 | Open in IMG/M |
| 3300031893|Ga0318536_10396334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300031897|Ga0318520_10589802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300031941|Ga0310912_11084755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031945|Ga0310913_11194645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300031947|Ga0310909_10888041 | Not Available | 732 | Open in IMG/M |
| 3300032025|Ga0318507_10135619 | Not Available | 1046 | Open in IMG/M |
| 3300032035|Ga0310911_10636292 | Not Available | 618 | Open in IMG/M |
| 3300032043|Ga0318556_10156713 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300032052|Ga0318506_10305476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300032094|Ga0318540_10451968 | Not Available | 621 | Open in IMG/M |
| 3300032205|Ga0307472_102036215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300032211|Ga0310896_10536846 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026815 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026870 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG3_08893400 | 2189573005 | Grass Soil | MADLAPTASRHVLAASTSAAAGESRWRVIARTAFPFLVVALLWEFTAYLGIFP |
| JGI10214J12806_108834632 | 3300000891 | Soil | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVA |
| C688J35102_1179830601 | 3300002568 | Soil | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAYL |
| Ga0062590_1023681722 | 3300004157 | Soil | MADLAPTVSRHVLAAPASAAASESRWRVIARTAFPFLVVAVLWEFTAYLG |
| Ga0066397_100882242 | 3300004281 | Tropical Forest Soil | MSDLAPAASPNVLASGASARRGESRLKVVARTAFPFLVVALAWEVT |
| Ga0066395_107366291 | 3300004633 | Tropical Forest Soil | MSDLAPAASPTIVAAASARRGESRWWVVARTAFPFLVVALAWELTAHLG |
| Ga0062594_1034134621 | 3300005093 | Soil | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAYLG |
| Ga0066674_102335381 | 3300005166 | Soil | MSDLAPATSASVLTAGTSAQRGESRWRVIARTAFPFLVVGIAWEITARL |
| Ga0070683_1004578102 | 3300005329 | Corn Rhizosphere | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIFPR |
| Ga0070690_1000371274 | 3300005330 | Switchgrass Rhizosphere | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVA |
| Ga0066388_1077327901 | 3300005332 | Tropical Forest Soil | MSDLAPTASPQVIAAATPAAAGESRWRIVARTAFPFLVVALLWE |
| Ga0070668_1018915821 | 3300005347 | Switchgrass Rhizosphere | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIF |
| Ga0070671_1002921041 | 3300005355 | Switchgrass Rhizosphere | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIFPRKL |
| Ga0070673_1024066871 | 3300005364 | Switchgrass Rhizosphere | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVAVLW |
| Ga0070663_1008845762 | 3300005455 | Corn Rhizosphere | MSDLAPTASPHVLTAATSAAAGESRWRVAARTAFPFLVVAVLWEFTAYLGIFP |
| Ga0070664_1017376401 | 3300005564 | Corn Rhizosphere | MADLAPTVSRHVLAAPASAAASESRWRVIARTAFPFLVVAV |
| Ga0066905_1000091756 | 3300005713 | Tropical Forest Soil | MANFAPATSPHALTAGTSSQRGESRWRIMARTAFPFLVVALAWEATA |
| Ga0066905_1018880902 | 3300005713 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRLKVVARTAFPFLVVALAWEVTAHLGIFPR |
| Ga0066903_1000571111 | 3300005764 | Tropical Forest Soil | LSNTVLPNYRKPMSDIAPTTSPAALTAAISSPRGESRLRVVARTAFPFLVVALLWEITAYLGV |
| Ga0075365_106924781 | 3300006038 | Populus Endosphere | MSELAPAASTQLLAATTAAATGESRWRVAARTAFPFLVVGALWEVTAHLGVF |
| Ga0075023_1005202701 | 3300006041 | Watersheds | MADLAPTASPHVLAASTSAAAGESRWRVVARTAFPFLVVALLWEFTAYL |
| Ga0075364_106379592 | 3300006051 | Populus Endosphere | MSDLAPAASPHVLAAGTPGARGESRLWVIARTAFP |
| Ga0075364_106851111 | 3300006051 | Populus Endosphere | MSDLAPTASPQVIAAATPATAGESRWRIVARTAFPFLV |
| Ga0075018_100590261 | 3300006172 | Watersheds | MSNLAPAASPHVLTAGTPLQRGESRWRVIARTAFPFLVVALAWEATAHAG |
| Ga0075436_1011014542 | 3300006914 | Populus Rhizosphere | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVV |
| Ga0075435_1010592121 | 3300007076 | Populus Rhizosphere | MSDLAPAASPSVVAAASARRGESRWRLVARTAFPFLVVALAWEVTAHLGI |
| Ga0105245_116629211 | 3300009098 | Miscanthus Rhizosphere | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAY |
| Ga0114129_135231541 | 3300009147 | Populus Rhizosphere | MSDLAPAASPHVLAAGTPGARGESRLWVIARTAFPFLV |
| Ga0105243_117322821 | 3300009148 | Miscanthus Rhizosphere | MSDLAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIF |
| Ga0075423_105435743 | 3300009162 | Populus Rhizosphere | MSDLAPAASPSVVAAASARRGESRWWVVARTAFPFLVVAL |
| Ga0126374_114735442 | 3300009792 | Tropical Forest Soil | MLDVHSISAAAKARAGYRESRWRVVARTAFPFVVVAAIWEGLAHAGIFPAR |
| Ga0126373_115176511 | 3300010048 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRWRIVARTAFPFLVVALLWEVTAH |
| Ga0126373_121391041 | 3300010048 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALLWEITA |
| Ga0126370_112456001 | 3300010358 | Tropical Forest Soil | MSDLAPAASPSVVAAASARRGESRWWLVARTAFPFLVVALAWEVT |
| Ga0126370_122593051 | 3300010358 | Tropical Forest Soil | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFLVVALAWEVTAHLGI |
| Ga0126372_111271271 | 3300010360 | Tropical Forest Soil | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFLVVALAWEVT |
| Ga0126372_116331951 | 3300010360 | Tropical Forest Soil | MSDLAPAASPNVLTGRTSARRGESRLRVVARTAFPFLVVALAWEVTAHLGIFPRK |
| Ga0126378_121547461 | 3300010361 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVA |
| Ga0126378_125301772 | 3300010361 | Tropical Forest Soil | MSDVAPAASPNVLTAGTSARRGESRLRVVARTAFPFLVVALAWEVTAHLGIFP |
| Ga0126377_115637931 | 3300010362 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRLRVVARTAFPFLVVALAWEVAAHLGIFPRKL |
| Ga0134125_102302083 | 3300010371 | Terrestrial Soil | MADLAPTVSRHVLAAPASAAASESRWRVIARTAFP |
| Ga0126381_1033263341 | 3300010376 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALLWEVTAH |
| Ga0137391_100882834 | 3300011270 | Vadose Zone Soil | MSELAPSASPNVLTAASARGESPLRLIARNAFPFLVVALLWEFTARLGVFP |
| Ga0137389_110322181 | 3300012096 | Vadose Zone Soil | MSELAPAVSAQVLAGTSAVHRESRLRVIARTAFPFLVVGLLWEVT |
| Ga0137368_101967972 | 3300012358 | Vadose Zone Soil | MSDLAPAASPHVLSGRISARRGESPLKVVARTAFPFVVVALAWELTA |
| Ga0137385_104120261 | 3300012359 | Vadose Zone Soil | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFLVVARAW |
| Ga0137375_104267532 | 3300012360 | Vadose Zone Soil | MSDLAPATSASVLTAGTSAQRGESRWRVIARTAFPFLVVGIAWEITAHLG |
| Ga0137360_103506442 | 3300012361 | Vadose Zone Soil | MSDLAPAASPSVVAAASARRGESRWWVVARTAFPFLVVALAWEITA |
| Ga0137407_117450662 | 3300012930 | Vadose Zone Soil | MSDLAPAASPHVLAAAASARRGESRWWVVARTAFPFLVVAL |
| Ga0164298_105783141 | 3300012955 | Soil | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVALAWEFTAYLGIFPRK |
| Ga0164302_119072751 | 3300012961 | Soil | MSELAPTVSPHVLTSAPSAAAGESRWRVVARTAFPFLVVAVLWEF |
| Ga0126369_109056281 | 3300012971 | Tropical Forest Soil | MSDLAPTASPQVIAAATPDAAGESRWRIVARTAFPFLVVAL |
| Ga0164308_121823161 | 3300012985 | Soil | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIFPR |
| Ga0157374_101760221 | 3300013296 | Miscanthus Rhizosphere | MADLAPTVSRHVLAAPASAGAGESRWRVVARTAFPFLVVAVLWEFTAYLGIFPRK |
| Ga0157375_135046221 | 3300013308 | Miscanthus Rhizosphere | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVVAVLWEFTAYLSIF |
| Ga0157380_116994312 | 3300014326 | Switchgrass Rhizosphere | MADLAPTASRHVLAAPVSAAAESRWRVVARTAFPFLVVAVLWEFTAYLGIF |
| Ga0132255_1015543313 | 3300015374 | Arabidopsis Rhizosphere | MSDLAPTASPNVIAAEGSASRGESRLSAVARNSVPFLVVAVLW |
| Ga0132255_1032175491 | 3300015374 | Arabidopsis Rhizosphere | MSDLAPTASPHVVAAATPAAAGESRWRIVARTAFPFLVVALFWEVTAQL |
| Ga0182040_101078601 | 3300016387 | Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPF |
| Ga0182040_105325891 | 3300016387 | Soil | MSDLAPAASPTVVASASARRGESRWWVVARTAFPFLVVALAWEVTAD |
| Ga0182038_101445271 | 3300016445 | Soil | MSDLAPAASPSVVAAASARRGESRWWVVARTAFPFLVVALAWEVTAHL |
| Ga0184625_102544002 | 3300018081 | Groundwater Sediment | MADLAPTVSRHVFAAPASAAASESRWRVIARTAFPFLVVAVLWEFTAHL |
| Ga0066662_101857461 | 3300018468 | Grasslands Soil | MSDLAPATSASVLTAGTSAQRGESRWRVIARTAFPFLVVGIAWEI |
| Ga0190270_134425731 | 3300018469 | Soil | MSDLAPAASPGAIAAGISAARGESRLWVIARNAFPFLVVGLL |
| Ga0193743_11618911 | 3300019889 | Soil | MADLAPTVSRHVLAPPASAAAGESRWRVVARTAFPFLLVAV |
| Ga0193730_11733701 | 3300020002 | Soil | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPF |
| Ga0210392_100614081 | 3300021475 | Soil | MSTVAPAASPPLLPAGPAAQRGERRWRLIARTAFPFLVVALAWEATARLGIFPRK |
| Ga0126371_136977661 | 3300021560 | Tropical Forest Soil | MADLAPASSPYVLTAGTAARHGESRWRLIARNAFPFL |
| Ga0207694_118819311 | 3300025924 | Corn Rhizosphere | MADLAPTVSRHVLAAPASAAASESRWRVIARTAFPF |
| Ga0207668_117351421 | 3300025972 | Switchgrass Rhizosphere | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVALAW |
| Ga0207641_122657831 | 3300026088 | Switchgrass Rhizosphere | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVALAWEF |
| Ga0209805_14143592 | 3300026542 | Soil | MAELAPIASPDLVTPRAAARRGESRLRIVARNAFPFLVVAL |
| Ga0207442_1027312 | 3300026815 | Soil | MADLAPTASPHVLAASTSAAAGESRWRVIARTAFPFLVVAL |
| Ga0208762_10012662 | 3300026870 | Soil | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWEF |
| Ga0209656_103600141 | 3300027812 | Bog Forest Soil | MSQVAPAASPGVLVAAASSALGESRWLLIARTAFPFLVVALAWEV |
| Ga0209465_104523082 | 3300027874 | Tropical Forest Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALAWELTAHLGVFPRK |
| Ga0247821_112666231 | 3300028596 | Soil | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWE |
| Ga0307307_102752371 | 3300028718 | Soil | MADLAPTASRHVLAASTSAAAGESRWRVVARTAFPFLVVALLWEFTAS |
| Ga0307284_103615562 | 3300028799 | Soil | MSELAPTASPHVLTAATSAAAGESRWRVVARTAFPFLVV |
| Ga0307308_106476111 | 3300028884 | Soil | MADLAPTASRHVLAASTSAAAGESRWRVIARTAFPFLVVALLWEFTAYLGIFTRK |
| Ga0307501_100904802 | 3300031152 | Soil | MADLAPTASRLVLAASTSAAAGESRWRVIARTAFPFLVVALLW |
| Ga0318541_102228521 | 3300031545 | Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALLWEVTAHLG |
| Ga0318538_100737671 | 3300031546 | Soil | MADLAPASSPYVLTAGTAVRHGESRWRIIARNAFPFLVVALAWEVTA |
| Ga0318528_104323411 | 3300031561 | Soil | MSDLAPTASPATLAAATSSARGESRLRVIARTAFP |
| Ga0318573_103039491 | 3300031564 | Soil | MSDLAPAASPSVVAAASARRGESRWWLVARTAFPFLVVALAWEVTA |
| Ga0310915_101828881 | 3300031573 | Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALLWEVTAHLGIFP |
| Ga0318542_106429552 | 3300031668 | Soil | MADLAPASSPYVLTAGTAVRHGESRWRIIARNAFPFLVVALAWE |
| Ga0318494_105335332 | 3300031751 | Soil | MSDLAPAASPSVVAAASARRGESRWWVVARTAFPFLVVALAWEVTA |
| Ga0318566_100009179 | 3300031779 | Soil | MSDLAPAASPTIVAAASARRGESRWWVVARTAFPFLVVALAW |
| Ga0310917_102281521 | 3300031833 | Soil | MSDLAPAASPTVVAAASARRGESRLKVVARTAFPFL |
| Ga0318517_101292982 | 3300031835 | Soil | MSDLAPAASPSVVAAASARRGESRWWLVARTAFPF |
| Ga0306919_100654793 | 3300031879 | Soil | MSDLAPAASPTVVAAASARRGESRWWIVARTTFPFVVVALAWEVTAHLGI |
| Ga0306919_114493871 | 3300031879 | Soil | MSDLAPAASPTVVAAASARRGESRWWVVARTAFPFLVVALLWEVTAHL |
| Ga0318536_103963342 | 3300031893 | Soil | MSDLAPAASPSVVAAASARRGESRWWLVARTAFPFLVVALAW |
| Ga0318520_105898022 | 3300031897 | Soil | MSDLAPAASPTVVASASARRGESRWWVVARTAFPFLVVALAWEVTADLGI |
| Ga0310912_110847551 | 3300031941 | Soil | MADLAPASSPYVLTAGTAVRHGESRWRIIARNAFPFLVV |
| Ga0310913_111946451 | 3300031945 | Soil | MSDLAPAASPTIVAAASARRGESRWWVVARTAFPFLVV |
| Ga0310909_108880411 | 3300031947 | Soil | MSDLAPAASPSVVAAASARRGESRWWLVARTAFPFLVVAL |
| Ga0318507_101356192 | 3300032025 | Soil | MSDLAPAASPSVVAAASARRGESRWWVVARTAFPFLVVALAWEV |
| Ga0310911_106362921 | 3300032035 | Soil | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFL |
| Ga0318556_101567132 | 3300032043 | Soil | MADLAPAASPSVVIARASAQRGESRLWIIARNAFPFLVVALAW |
| Ga0318506_103054762 | 3300032052 | Soil | MSDLAPAASPTVVAAASARRGESRLKVVARTAFPFLVVALAWEVTAHLGIFP |
| Ga0318540_104519681 | 3300032094 | Soil | MSDLAPAASPSVVAAASARRGESRWRVVARTAFPFLVVALAWEVTAHL |
| Ga0307472_1020362152 | 3300032205 | Hardwood Forest Soil | MSDLAPTASPNVLVAGAAAARGESRLRIVARNAFPFLVVGLLWEVTA |
| Ga0310896_105368461 | 3300032211 | Soil | MADLAPTVSRHVLAAPASAAAGESRWRVVARTAFPFLVVAVLWEFTAYLGIFP |
| ⦗Top⦘ |