


| Basic Information | |
|---|---|
| Family ID | F096000 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 38 residues |
| Representative Sequence | KQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAASAATDAK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00574 | CLP_protease | 81.90 |
| PF06689 | zf-C4_ClpX | 5.71 |
| PF07724 | AAA_2 | 4.76 |
| PF10431 | ClpB_D2-small | 2.86 |
| PF02190 | LON_substr_bdg | 1.90 |
| PF07498 | Rho_N | 1.90 |
| PF00152 | tRNA-synt_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 163.81 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 163.81 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 81.90 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.10 % |
| Unclassified | root | N/A | 1.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10057087 | Not Available | 2944 | Open in IMG/M |
| 3300001593|JGI12635J15846_10310217 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300001593|JGI12635J15846_10434843 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101052729 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300002560|JGI25383J37093_10217411 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300002908|JGI25382J43887_10521357 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004092|Ga0062389_101079865 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300004092|Ga0062389_101805468 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300004119|Ga0058887_1498162 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300004139|Ga0058897_11183583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1450 | Open in IMG/M |
| 3300004479|Ga0062595_101361260 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005552|Ga0066701_10593755 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005587|Ga0066654_10607569 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005591|Ga0070761_10294632 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005598|Ga0066706_10535444 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005610|Ga0070763_10223406 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300006032|Ga0066696_10420828 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006052|Ga0075029_101055759 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006086|Ga0075019_10171567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1275 | Open in IMG/M |
| 3300006172|Ga0075018_10202064 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300006173|Ga0070716_100505096 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300006174|Ga0075014_100526071 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006358|Ga0068871_100747735 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300009012|Ga0066710_102547534 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300009012|Ga0066710_103067570 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009090|Ga0099827_10352028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1253 | Open in IMG/M |
| 3300009518|Ga0116128_1024368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2041 | Open in IMG/M |
| 3300009839|Ga0116223_10151790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1438 | Open in IMG/M |
| 3300010046|Ga0126384_12221093 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010154|Ga0127503_10936879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6146 | Open in IMG/M |
| 3300010321|Ga0134067_10234030 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010335|Ga0134063_10541765 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010339|Ga0074046_10007618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8366 | Open in IMG/M |
| 3300010339|Ga0074046_10266708 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300010339|Ga0074046_10727567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 582 | Open in IMG/M |
| 3300010359|Ga0126376_10099697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2211 | Open in IMG/M |
| 3300010359|Ga0126376_12441266 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010360|Ga0126372_10408807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1242 | Open in IMG/M |
| 3300010376|Ga0126381_102480205 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010866|Ga0126344_1154003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1446 | Open in IMG/M |
| 3300011120|Ga0150983_10380639 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300011120|Ga0150983_13550229 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300011120|Ga0150983_13841726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1261 | Open in IMG/M |
| 3300011120|Ga0150983_15043341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1671 | Open in IMG/M |
| 3300011120|Ga0150983_15719974 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300011120|Ga0150983_15732151 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300011269|Ga0137392_10733979 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300011269|Ga0137392_10834694 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012096|Ga0137389_11250986 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012096|Ga0137389_11476247 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012189|Ga0137388_10629240 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300012199|Ga0137383_10001410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14260 | Open in IMG/M |
| 3300012359|Ga0137385_10787726 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012361|Ga0137360_10576324 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012385|Ga0134023_1126710 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012683|Ga0137398_10398396 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012922|Ga0137394_10564941 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012971|Ga0126369_11776713 | Not Available | 705 | Open in IMG/M |
| 3300012971|Ga0126369_11863342 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300016341|Ga0182035_11626247 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300016404|Ga0182037_10913230 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300017929|Ga0187849_1047214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2040 | Open in IMG/M |
| 3300017934|Ga0187803_10212364 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300017938|Ga0187854_10052103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2041 | Open in IMG/M |
| 3300017947|Ga0187785_10311995 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300019264|Ga0187796_1018579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1501 | Open in IMG/M |
| 3300020140|Ga0179590_1002373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3230 | Open in IMG/M |
| 3300020199|Ga0179592_10002046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8339 | Open in IMG/M |
| 3300020199|Ga0179592_10208853 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300020579|Ga0210407_10437295 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300020579|Ga0210407_11265548 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300020581|Ga0210399_10701415 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300020581|Ga0210399_10790900 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300021086|Ga0179596_10394603 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300021178|Ga0210408_10910204 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300021178|Ga0210408_11492607 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021404|Ga0210389_10560075 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300021406|Ga0210386_11600320 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021559|Ga0210409_10607350 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300021559|Ga0210409_11600982 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300022533|Ga0242662_10071827 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300022724|Ga0242665_10017673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1592 | Open in IMG/M |
| 3300024249|Ga0247676_1007236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1672 | Open in IMG/M |
| 3300025320|Ga0209171_10194611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1149 | Open in IMG/M |
| 3300026035|Ga0207703_10186026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
| 3300026304|Ga0209240_1282436 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026361|Ga0257176_1067629 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300026515|Ga0257158_1004865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1850 | Open in IMG/M |
| 3300026538|Ga0209056_10314247 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300026551|Ga0209648_10827549 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027663|Ga0208990_1155167 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027910|Ga0209583_10594267 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300028138|Ga0247684_1015395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
| 3300029636|Ga0222749_10822159 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030730|Ga0307482_1117092 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031018|Ga0265773_1039373 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031231|Ga0170824_109503494 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031231|Ga0170824_112769733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1239 | Open in IMG/M |
| 3300031718|Ga0307474_10741056 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300031720|Ga0307469_10915741 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031947|Ga0310909_10965529 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300032173|Ga0315268_11242960 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300032174|Ga0307470_10475550 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300032180|Ga0307471_103026328 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300032783|Ga0335079_10553685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1219 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100570871 | 3300001593 | Forest Soil | TLDRMKAKLRSDKTLDWLAQNARIKTVAAASAATDAK* |
| JGI12635J15846_103102173 | 3300001593 | Forest Soil | QGTLDRMKAKLRSDKTLDWLAQNSRIRTIAAAGSK* |
| JGI12635J15846_104348432 | 3300001593 | Forest Soil | GTLDRIKAKLRSDKTLDWLAQNARVSTTATAAGAK* |
| JGIcombinedJ26739_1010527291 | 3300002245 | Forest Soil | QGTLDRIKAKLRSDKTLDWLAQNARVSTTAAAAGAK* |
| JGI25383J37093_102174112 | 3300002560 | Grasslands Soil | QGALDRMKAKLRSDKTLDWLAQNAKIKTVAAASAATDAK* |
| JGI25382J43887_105213572 | 3300002908 | Grasslands Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK* |
| Ga0062389_1010798653 | 3300004092 | Bog Forest Soil | RLTKQGTLDRMKAKLRSDKTLDWLAQNSRIRTIAAASAAEAK* |
| Ga0062389_1018054682 | 3300004092 | Bog Forest Soil | RLTKQGTLDRMKAKLRSDKTLDWLAQKSRIRTVAAAETK* |
| Ga0058887_14981621 | 3300004119 | Forest Soil | KQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAASAATDAK* |
| Ga0058897_111835831 | 3300004139 | Forest Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAAAATDSK* |
| Ga0062595_1013612602 | 3300004479 | Soil | GTLDRMKAKLRSDKTLDWLAQNSQIRTVAADESKQQSSES* |
| Ga0066701_105937552 | 3300005552 | Soil | LDRMKAKLRSDKTLDRLAQNAKIKTVAAASAATDAK* |
| Ga0066654_106075692 | 3300005587 | Soil | GTLDRMKAKLRSDKTLEWLEQNAKIKTVAAANAATDAK* |
| Ga0070761_102946322 | 3300005591 | Soil | GALDRMKAKLRSDKTLDWLAQNAQIKTVAAASAAAADAK* |
| Ga0066706_105354441 | 3300005598 | Soil | GTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDSK* |
| Ga0070763_102234061 | 3300005610 | Soil | TLDRMKSKLRSDKTLDWLAQNSRISTVAPAETKSDAAESK* |
| Ga0066696_104208281 | 3300006032 | Soil | RAGLTKQGTLDRMKAKLRSDKTLDWLAQNSKIRMVAAADTK* |
| Ga0075029_1010557591 | 3300006052 | Watersheds | ASLTKQGTLDRMKAKLRSDKTLDWLAQNAAVKTVAAASAK* |
| Ga0075019_101715673 | 3300006086 | Watersheds | ARLTKQGTLDRMKAKLRSDKTLDWLAQNAKIKIVAAASAATDAK* |
| Ga0075018_102020641 | 3300006172 | Watersheds | TLDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK* |
| Ga0070716_1005050964 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDRMKAKLRSDKTLDWLAQNSRIGTVAAAEASEKSSSA* |
| Ga0075014_1005260712 | 3300006174 | Watersheds | KQGTLDRMKAKLRSDKTLDWLAQNSRIRTVAATESK* |
| Ga0068871_1007477351 | 3300006358 | Miscanthus Rhizosphere | RLTKQGALDRMKAKLRSDKTLDWLAQNANVRPAAAAAGS* |
| Ga0066710_1025475342 | 3300009012 | Grasslands Soil | ARLTKQGALDRMRAKLRSDKTLDWLAQNANVRPAAAAAGD |
| Ga0066710_1030675701 | 3300009012 | Grasslands Soil | GTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDSK |
| Ga0099827_103520281 | 3300009090 | Vadose Zone Soil | GTLDRIKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0116128_10243681 | 3300009518 | Peatland | ALDRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVK* |
| Ga0116223_101517901 | 3300009839 | Peatlands Soil | DRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVK* |
| Ga0126384_122210932 | 3300010046 | Tropical Forest Soil | TKQGTLDSMKAKLRSDKTLDWLAQNSKIRTIAAASSK* |
| Ga0127503_109368791 | 3300010154 | Soil | QGTLDRMKAKLRSDKTLDWLAQNATVKTVAAASAK* |
| Ga0134067_102340301 | 3300010321 | Grasslands Soil | QGTLDRMKAKLRSDKTLEWIEQSAKIKTVAAANAATDAK* |
| Ga0134063_105417652 | 3300010335 | Grasslands Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0074046_100076181 | 3300010339 | Bog Forest Soil | KQGALDRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVK* |
| Ga0074046_102667081 | 3300010339 | Bog Forest Soil | LDRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVE* |
| Ga0074046_107275672 | 3300010339 | Bog Forest Soil | DRMKAKLRSDKTLDWLAQNAQVKNVAAESAAAADAK* |
| Ga0126376_100996973 | 3300010359 | Tropical Forest Soil | GALDRMKAKLRSDKTLDWLAQNAKIRTAAAAAGK* |
| Ga0126376_124412661 | 3300010359 | Tropical Forest Soil | RLTKQGALDRMKAKLRSDKTLDWLAQNANVRTAAAAAGS* |
| Ga0126372_104088071 | 3300010360 | Tropical Forest Soil | DRMKAKLRSDKTLDWLAQQAKIKTVEAASAATDAK* |
| Ga0126381_1024802051 | 3300010376 | Tropical Forest Soil | TKQGTLDRMKAKLRSDKTLEWIEQKAKIKTVAAASAATDAK* |
| Ga0126344_11540033 | 3300010866 | Boreal Forest Soil | LDRMKAKLRSDKTLDWLAQNAQVKTVAAASAAADSK* |
| Ga0150983_103806391 | 3300011120 | Forest Soil | TLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0150983_135502292 | 3300011120 | Forest Soil | LTKQGALDRMKAKLRSDKTLDWLAQNAEIKTVAVASTAADAK* |
| Ga0150983_138417263 | 3300011120 | Forest Soil | GTLDRMKAKLRSDKTLDWLAQNSRIRTVAAAETK* |
| Ga0150983_150433413 | 3300011120 | Forest Soil | GTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAVAATDAK* |
| Ga0150983_157199742 | 3300011120 | Forest Soil | DRMKSKLRSDKTLDWLAQNSRIRTVAAAKAAETT* |
| Ga0150983_157321511 | 3300011120 | Forest Soil | DRMKAKLRSDKTLDWLAQNAQVKTVAAASATADAK* |
| Ga0137392_107339791 | 3300011269 | Vadose Zone Soil | GTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0137392_108346942 | 3300011269 | Vadose Zone Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAVANAATDSK* |
| Ga0137389_112509862 | 3300012096 | Vadose Zone Soil | RLTKQGALDRMKAKLRSDKTLDWLAQNANVRTAAAAASS* |
| Ga0137389_114762471 | 3300012096 | Vadose Zone Soil | GALDRMKAKLRSDNTLDWLAQHANVRTAAAAAGS* |
| Ga0137388_106292401 | 3300012189 | Vadose Zone Soil | KQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0137383_100014101 | 3300012199 | Vadose Zone Soil | TKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK* |
| Ga0137385_107877261 | 3300012359 | Vadose Zone Soil | LDRMKAKLRSDKTLEWIEQSAKLKTVAAANAATDAK* |
| Ga0137360_105763242 | 3300012361 | Vadose Zone Soil | LDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK* |
| Ga0134023_11267101 | 3300012385 | Grasslands Soil | RMKAKLRSDKTLDWIAQNAKIKTVATANAATDSK* |
| Ga0137398_103983961 | 3300012683 | Vadose Zone Soil | DRMKAKLRSDKTLDWLAQNAKIKTVAAASAATDAK* |
| Ga0137394_105649411 | 3300012922 | Vadose Zone Soil | QGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK* |
| Ga0126369_117767132 | 3300012971 | Tropical Forest Soil | LTKQGALDRMKAKLRSDKTLDWLAQNANVRTAAAAAGS* |
| Ga0126369_118633421 | 3300012971 | Tropical Forest Soil | TKQGALDRMKAKLRSDKTLDWLAQNAKIRTAAAAAGKPA* |
| Ga0182035_116262471 | 3300016341 | Soil | ALDRMKAKLRSDKTLDWLAQNAKIRTAAAAAGKPA |
| Ga0182037_109132301 | 3300016404 | Soil | TLDRMKAKLRSDKTLEWLEQNAKIKTVAVANAATDAK |
| Ga0187849_10472141 | 3300017929 | Peatland | LDRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVK |
| Ga0187803_102123641 | 3300017934 | Freshwater Sediment | KQGALDRMKAKLRSDKTVDWLAQSAKVKTVPAASATSAK |
| Ga0187854_100521031 | 3300017938 | Peatland | ALDRMKAKLRSDKTVDWLAQTAKVKTVAAASATSVK |
| Ga0187785_103119951 | 3300017947 | Tropical Peatland | KQGALDRMKAKLRSDKTVDWLAQNARVKTVAAASAK |
| Ga0187796_10185791 | 3300019264 | Peatland | KQGGLDRMKAKLRSDKTLDWLAQQAKIKTVAAASAAEAK |
| Ga0179590_10023731 | 3300020140 | Vadose Zone Soil | QGALNRMKAKLRSDKTIDWLAQNASVKTVAAASAK |
| Ga0179592_100020466 | 3300020199 | Vadose Zone Soil | TKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK |
| Ga0179592_102088531 | 3300020199 | Vadose Zone Soil | QGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK |
| Ga0210407_104372953 | 3300020579 | Soil | GTLDRMKSKLRSDKTLDWLAQNSRIRTVAAAKAAETT |
| Ga0210407_112655482 | 3300020579 | Soil | LTKQGALDRMKAKLRSDKTLDWLAQNAQIKTVAVASAATDAK |
| Ga0210399_107014151 | 3300020581 | Soil | QGALDRMKAKLRSDKTLDWLAQNAQIKTVAAASAATDSK |
| Ga0210399_107909001 | 3300020581 | Soil | QGTLDRMKAKLRSDKTLDWLAQNAKIRTVAAASAATDAK |
| Ga0179596_103946032 | 3300021086 | Vadose Zone Soil | KQGTLDRMKAKLRSDKTLDWLAQNAKVKTVAAAIAATDSK |
| Ga0210408_109102041 | 3300021178 | Soil | KQGTLDRMRAKLRSDKTLDWLAQNATVKTVAAASAK |
| Ga0210408_114926072 | 3300021178 | Soil | DRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK |
| Ga0210389_105600752 | 3300021404 | Soil | DRMKSKLRSDKTLDWLAQNSRIRTVAPAETKSDAAESK |
| Ga0210386_116003202 | 3300021406 | Soil | DRMKAKLRSDKTLDWLAQNAQIKTVAAASAAADSK |
| Ga0210409_106073502 | 3300021559 | Soil | GTLDRMKAKLRSDKTLDWLAQNAKVKTVAAAIAATDSK |
| Ga0210409_116009822 | 3300021559 | Soil | LTKQGALDRMKAKLRSDKTLDWLAQNAQIKTVAAASAAAADSK |
| Ga0242662_100718272 | 3300022533 | Soil | GTLDRIKAKLRSDKTLDWLAQNAEVKTVAAASAATDSK |
| Ga0242665_100176731 | 3300022724 | Soil | TLDRMKAKLRSDKTLDWLAQNAKVKTVAAAIAATDSK |
| Ga0247676_10072363 | 3300024249 | Soil | TKQGALDRMKAKLRSDKTLDWLAQNAKIRTAAAAAGK |
| Ga0209171_101946111 | 3300025320 | Iron-Sulfur Acid Spring | TKQGTLDRIKAKLRSDKTLDWLAQNARVSTTAAAAGAK |
| Ga0207703_101860263 | 3300026035 | Switchgrass Rhizosphere | RLTKQGALDRMKAKLRSDKTLDWLAQNANVRNAAAAAGS |
| Ga0209240_12824361 | 3300026304 | Grasslands Soil | QGALDRMRAKLRSDKTIDWLAQNASVKTVAAASAK |
| Ga0257176_10676291 | 3300026361 | Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAAIAATDSK |
| Ga0257158_10048653 | 3300026515 | Soil | GTLDRMKAKLRSDKALDWLAQNAKIKTVAAANAATDAK |
| Ga0209056_103142471 | 3300026538 | Soil | KQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDSK |
| Ga0209648_108275491 | 3300026551 | Grasslands Soil | TKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDSK |
| Ga0208990_11551672 | 3300027663 | Forest Soil | LTKQGTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK |
| Ga0209583_105942671 | 3300027910 | Watersheds | TKQGALDRMKAKLRSDKTIDWLAQNASVKTVAAASAK |
| Ga0247684_10153953 | 3300028138 | Soil | TKQGALDRMKAKLRSDKTLDWLAQNAQIKTVAAASAATDSK |
| Ga0222749_108221591 | 3300029636 | Soil | KQGTLDRMKAKLRSDKTLDWLAQNSRIRTVAATETKSPESGS |
| Ga0307482_11170921 | 3300030730 | Hardwood Forest Soil | TLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDSK |
| Ga0265773_10393732 | 3300031018 | Soil | LTKQGALDRMKAKLRSDKTLDWLAQNAQIKTVAAASAATDSK |
| Ga0170824_1095034942 | 3300031231 | Forest Soil | GTLDRMKAKLRSDKTLDWLAQNAKIKTVAAANAATDAK |
| Ga0170824_1127697331 | 3300031231 | Forest Soil | QGALDRMKSKLRSDKTLDWLAQNSRIRTVAPTETETKSEAPESK |
| Ga0307474_107410561 | 3300031718 | Hardwood Forest Soil | KQGTLDRMKAKLRSDKTLDWLAQNSRIRTVAATESK |
| Ga0307469_109157412 | 3300031720 | Hardwood Forest Soil | KQGALDRMKAKLRSDKTLDWLAQNAKIRTAAAAAGK |
| Ga0310909_109655291 | 3300031947 | Soil | KQGTLDRMKAKLRSDKTLDWLAQNATVKTVAAASAK |
| Ga0315268_112429602 | 3300032173 | Sediment | SLDRMKAKLRSYKTLDWLAQNSRIQTVAPAAAEAK |
| Ga0307470_104755501 | 3300032174 | Hardwood Forest Soil | QGTLDRMKAKLRSDKTLDWLAQNSQIRTVAADESKQQSSES |
| Ga0307471_1030263281 | 3300032180 | Hardwood Forest Soil | DRMKAKLRSDKTLDWLAQNAKIKTVAAAAAATDSK |
| Ga0335079_105536851 | 3300032783 | Soil | TKQGALDRMKATLRSDKTVDWLAQNAHVKTVAAASAK |
| ⦗Top⦘ |