


| Basic Information | |
|---|---|
| Family ID | F095942 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LSDDPDPVAVRLDLRPWGHERLRLMEPGAAGLAPRPDLFPSANPLG |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.048 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (29.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.952 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.05% β-sheet: 0.00% Coil/Unstructured: 95.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01597 | GCV_H | 62.86 |
| PF02347 | GDC-P | 19.05 |
| PF13483 | Lactamase_B_3 | 10.48 |
| PF12706 | Lactamase_B_2 | 2.86 |
| PF00753 | Lactamase_B | 1.90 |
| PF12911 | OppC_N | 0.95 |
| PF03099 | BPL_LplA_LipB | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 62.86 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 19.05 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 19.05 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.95 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.95 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.05 % |
| Unclassified | root | N/A | 0.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1055841 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 638 | Open in IMG/M |
| 3300002558|JGI25385J37094_10100292 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005166|Ga0066674_10451516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 587 | Open in IMG/M |
| 3300005167|Ga0066672_10021959 | All Organisms → cellular organisms → Bacteria | 3358 | Open in IMG/M |
| 3300005167|Ga0066672_10355090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 957 | Open in IMG/M |
| 3300005178|Ga0066688_10227137 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005178|Ga0066688_10718135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 633 | Open in IMG/M |
| 3300005179|Ga0066684_10305218 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005187|Ga0066675_11423311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 507 | Open in IMG/M |
| 3300005406|Ga0070703_10327314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 647 | Open in IMG/M |
| 3300005434|Ga0070709_10868043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 712 | Open in IMG/M |
| 3300005444|Ga0070694_100512091 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005446|Ga0066686_10398574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 940 | Open in IMG/M |
| 3300005446|Ga0066686_10748517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 655 | Open in IMG/M |
| 3300005451|Ga0066681_10261060 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005540|Ga0066697_10148983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1382 | Open in IMG/M |
| 3300005552|Ga0066701_10896457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 526 | Open in IMG/M |
| 3300005556|Ga0066707_10150542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1474 | Open in IMG/M |
| 3300005558|Ga0066698_10772239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 625 | Open in IMG/M |
| 3300005569|Ga0066705_10833994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 549 | Open in IMG/M |
| 3300006173|Ga0070716_100632257 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006755|Ga0079222_10039030 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300006797|Ga0066659_11024117 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006797|Ga0066659_11371506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 590 | Open in IMG/M |
| 3300006804|Ga0079221_10787370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 679 | Open in IMG/M |
| 3300006914|Ga0075436_100053171 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300007255|Ga0099791_10163747 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300007258|Ga0099793_10609161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 547 | Open in IMG/M |
| 3300009012|Ga0066710_103056314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 649 | Open in IMG/M |
| 3300009812|Ga0105067_1114951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 502 | Open in IMG/M |
| 3300009814|Ga0105082_1082549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 585 | Open in IMG/M |
| 3300010084|Ga0127461_1035276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 534 | Open in IMG/M |
| 3300010141|Ga0127499_1189646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 663 | Open in IMG/M |
| 3300010301|Ga0134070_10313522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 601 | Open in IMG/M |
| 3300010304|Ga0134088_10153278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1097 | Open in IMG/M |
| 3300010304|Ga0134088_10382680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 685 | Open in IMG/M |
| 3300010322|Ga0134084_10083172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 998 | Open in IMG/M |
| 3300010322|Ga0134084_10415262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 528 | Open in IMG/M |
| 3300010326|Ga0134065_10275288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 636 | Open in IMG/M |
| 3300010329|Ga0134111_10377658 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010329|Ga0134111_10381679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 600 | Open in IMG/M |
| 3300010333|Ga0134080_10535237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 561 | Open in IMG/M |
| 3300010337|Ga0134062_10240212 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300010938|Ga0137716_10238642 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300012198|Ga0137364_10180086 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300012198|Ga0137364_10691863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 769 | Open in IMG/M |
| 3300012203|Ga0137399_11236755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 629 | Open in IMG/M |
| 3300012209|Ga0137379_10438302 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300012211|Ga0137377_10448102 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012350|Ga0137372_10457786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 956 | Open in IMG/M |
| 3300012353|Ga0137367_10161457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1632 | Open in IMG/M |
| 3300012356|Ga0137371_10672774 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 793 | Open in IMG/M |
| 3300012357|Ga0137384_10505414 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300012362|Ga0137361_10800802 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012379|Ga0134058_1191024 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300012386|Ga0134046_1148248 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012388|Ga0134031_1252979 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300012399|Ga0134061_1224413 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012400|Ga0134048_1185957 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012405|Ga0134041_1418746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 649 | Open in IMG/M |
| 3300012410|Ga0134060_1486635 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012918|Ga0137396_10111024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1968 | Open in IMG/M |
| 3300012923|Ga0137359_10457184 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012972|Ga0134077_10100903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1117 | Open in IMG/M |
| 3300014166|Ga0134079_10756131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 502 | Open in IMG/M |
| 3300015264|Ga0137403_11256514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 586 | Open in IMG/M |
| 3300015356|Ga0134073_10060628 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300015357|Ga0134072_10021350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1617 | Open in IMG/M |
| 3300015357|Ga0134072_10120880 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300015371|Ga0132258_13711710 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1042 | Open in IMG/M |
| 3300017656|Ga0134112_10119641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 999 | Open in IMG/M |
| 3300018482|Ga0066669_12051924 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 537 | Open in IMG/M |
| 3300021086|Ga0179596_10491726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 622 | Open in IMG/M |
| 3300024275|Ga0247674_1021746 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300024330|Ga0137417_1339541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 630 | Open in IMG/M |
| 3300025164|Ga0209521_10161701 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300025322|Ga0209641_10100200 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300025922|Ga0207646_10192046 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300026296|Ga0209235_1001400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 13020 | Open in IMG/M |
| 3300026296|Ga0209235_1033989 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
| 3300026301|Ga0209238_1026245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2186 | Open in IMG/M |
| 3300026301|Ga0209238_1210824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 571 | Open in IMG/M |
| 3300026314|Ga0209268_1015151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2957 | Open in IMG/M |
| 3300026315|Ga0209686_1023271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2444 | Open in IMG/M |
| 3300026316|Ga0209155_1160840 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300026317|Ga0209154_1057805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1712 | Open in IMG/M |
| 3300026322|Ga0209687_1294371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 513 | Open in IMG/M |
| 3300026327|Ga0209266_1017966 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
| 3300026327|Ga0209266_1190302 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026327|Ga0209266_1230849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 616 | Open in IMG/M |
| 3300026331|Ga0209267_1110290 | Not Available | 1165 | Open in IMG/M |
| 3300026332|Ga0209803_1027590 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
| 3300026332|Ga0209803_1176076 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300026342|Ga0209057_1220090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 539 | Open in IMG/M |
| 3300026343|Ga0209159_1105478 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300026358|Ga0257166_1058184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 555 | Open in IMG/M |
| 3300026523|Ga0209808_1104859 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300026530|Ga0209807_1142793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 929 | Open in IMG/M |
| 3300026542|Ga0209805_1057626 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300027643|Ga0209076_1182830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 579 | Open in IMG/M |
| 3300027671|Ga0209588_1110227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 884 | Open in IMG/M |
| 3300027765|Ga0209073_10528412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 501 | Open in IMG/M |
| 3300027961|Ga0209853_1079049 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300032174|Ga0307470_10040315 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300032180|Ga0307471_101392715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 862 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 29.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 23.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10558412 | 3300002557 | Grasslands Soil | LVLLSDDPDPVAVRLDLRPWGADRLRLIEPGASGGAPRPDLFPSANPLG* |
| JGI25385J37094_101002921 | 3300002558 | Grasslands Soil | SDDPDPVAVRLDVRPWGHERLRLAEPGARGLAPRPDLFPEANPLA* |
| Ga0066674_104515161 | 3300005166 | Soil | PGVLALLSDDPDPVTVRLDLRPWGHEPLKLGEPDAAGVTPRPDLFPPHNPLG* |
| Ga0066672_100219591 | 3300005167 | Soil | VLAYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0066672_103550903 | 3300005167 | Soil | LVLLSDDPDPVAVRLDLRPWGADRLRLVEPGGRGVAPRPDLFPSANPLG* |
| Ga0066688_102271373 | 3300005178 | Soil | GRPGILVLLSDDPDPVAVRLDLRPWGAERLRLIEPGAHGAAPRPDLFPSANPLG* |
| Ga0066688_107181352 | 3300005178 | Soil | DPDPVAVRLDVRPWGYDRLHLVEPGAAGLAPRSDLFPSANPLA* |
| Ga0066684_103052183 | 3300005179 | Soil | VAVRLDLRPWGHDRLKLAEPDAAGLAPRPDLFPPHNPLG* |
| Ga0066675_114233112 | 3300005187 | Soil | PVAVRLDLRPWGYERLRLMEPGAAGLAPRSDLFPSGNPLG* |
| Ga0070703_103273142 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0070709_108680432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVLTSLSDDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0070694_1005120913 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PVAVRLDLRPWGSDRVSLTEHGSHGLAPRADLFPSPNTLA* |
| Ga0066686_103985743 | 3300005446 | Soil | SDDPDPVAVRLDLRPWGAGRVRLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0066686_107485171 | 3300005446 | Soil | ALSADPDPVAVRLDLRPWGGDRLRLVEPGAAGLAPRADLFPSANPLP* |
| Ga0066681_102610603 | 3300005451 | Soil | SADPDPVAVRLDLRPWGGDRLRLVEPGAAGLAPRADLFPSANPLP* |
| Ga0066697_101489831 | 3300005540 | Soil | AVRLDLRPWGADRLRLVEPGGRGVAPRPDLFPSANPLG* |
| Ga0066701_108964571 | 3300005552 | Soil | LSDDPDPVAVRLDLRPWGYERLRLVEPGAAGLKPRPDLFPAANPLP* |
| Ga0066707_101505423 | 3300005556 | Soil | SADPDPVAVRLDLRPWGAGRLLLVEPDATGLAPRSDLFPTANPLP* |
| Ga0066698_107722391 | 3300005558 | Soil | RPGVLTSLSDDPDPVAVRLDLRPWGAGRVRLVEPGAAGLAPRSDLFPFANPLP* |
| Ga0066705_108339942 | 3300005569 | Soil | AVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0070716_1006322573 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RLDLRPWGYDRLRLVEPGAAGLTPRADVFVAANPLP* |
| Ga0079222_100390304 | 3300006755 | Agricultural Soil | AYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0066659_110241173 | 3300006797 | Soil | RLDLRPWGAGRLLLVEPDAAGLAPRADLFPAANPLP* |
| Ga0066659_113715061 | 3300006797 | Soil | LSDDPDPVAVRLDLRPWGAGRLLLVEPGAAGLAPRADLFPSANPLP* |
| Ga0079221_107873702 | 3300006804 | Agricultural Soil | RPGVLAYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0075436_1000531711 | 3300006914 | Populus Rhizosphere | RAGRPGVLAYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANLLG* |
| Ga0099791_101637471 | 3300007255 | Vadose Zone Soil | HDPDPVAVRLDLRPWGAGRLLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0099793_106091611 | 3300007258 | Vadose Zone Soil | SDDPDPVAVRLDLRPWAAGRILLVEPGAAGLAPRPDLFPSANPLA* |
| Ga0066710_1030563142 | 3300009012 | Grasslands Soil | PVTVRLDLRPWGHEPLELAEPDAAGVTPRPDLFPPHNPLG |
| Ga0105067_11149511 | 3300009812 | Groundwater Sand | AGRPGVLVLLTDDPDPVAVRLDLRPWGFDRLKLTEPGAVGLRPRPDLFPSANPLA* |
| Ga0105082_10825492 | 3300009814 | Groundwater Sand | LVLLTDDPDPVAVRLDLRPWGFDRLKLTEPGAVGLRPRPDLFPSANPLA* |
| Ga0127461_10352762 | 3300010084 | Grasslands Soil | VAVRLDLRPWGHERLRLAEPGAAGVAPRPDLFPEANPLP* |
| Ga0127499_11896461 | 3300010141 | Grasslands Soil | PVAVRLDLRPWAAGRILLVEPGAAGLPPRPDLFPSANPLP* |
| Ga0134070_103135221 | 3300010301 | Grasslands Soil | TFLSEDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0134088_101532783 | 3300010304 | Grasslands Soil | DDPDPVAVRLDLRPWGAGRLLLVEPDATGLAPRSDLFPTANPLP* |
| Ga0134088_103826801 | 3300010304 | Grasslands Soil | RPGVLALLSDDPDPVAVRLDLRPWGHDRLKLAEPDAAGLAPRPDLFPRHNPLG* |
| Ga0134084_100831721 | 3300010322 | Grasslands Soil | PGVLTYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSPNPLA* |
| Ga0134084_104152621 | 3300010322 | Grasslands Soil | DPDPVAVRLDLRPWGAGRVRLVEPGAAGLAPRSDLFPFANPLP* |
| Ga0134065_102752882 | 3300010326 | Grasslands Soil | YLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0134111_103776583 | 3300010329 | Grasslands Soil | VLALLSDDPDPVTVRLDLRPWGHEPLELAEPDAAGVTPRPDLFPPHNPLG* |
| Ga0134111_103816792 | 3300010329 | Grasslands Soil | SLSDDPDPVAVRLDLRPWDAGRVLLVEPGAAGLAPRSDLFPSSNPLP* |
| Ga0134080_105352371 | 3300010333 | Grasslands Soil | AVRLDLRPWGGDRLALVEEGAAGLPPRADLFPSGKPLA* |
| Ga0134062_102402121 | 3300010337 | Grasslands Soil | DDPDPVAVRLDLRPWGHDRLKLAEPDAAGLAPRPDLFPRHNPLG* |
| Ga0137716_102386423 | 3300010938 | Hot Spring Fe-Si Sediment | AVRLDLRPWDGDRLLLGAPEGSGAAPRADLFPAPNPLP* |
| Ga0137364_101800861 | 3300012198 | Vadose Zone Soil | DLRPWGGDRLRLVEPGAAGLAPRADLFPSANPLP* |
| Ga0137364_106918633 | 3300012198 | Vadose Zone Soil | RLDLRPWGYERLRLMEPGAAGLAPRSDLFPSGNPLG* |
| Ga0137399_112367552 | 3300012203 | Vadose Zone Soil | TSLSDDPDPVAVRLDLRPWAAGRILLVEPGAAGLAPRPDLFPSANPLA* |
| Ga0137379_104383021 | 3300012209 | Vadose Zone Soil | VAVRLDLRPWGGDRLALVEEGAAGLPPRADLFPAGNPLP* |
| Ga0137377_104481021 | 3300012211 | Vadose Zone Soil | DLRPWGYEWLRLVEPGAAGLTPRSDLFPAANPLP* |
| Ga0137372_104577863 | 3300012350 | Vadose Zone Soil | PGVLAYLSDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSGNPLG* |
| Ga0137367_101614573 | 3300012353 | Vadose Zone Soil | AVRLDLRPWGYERLRLVEPGAAGLAPRPDLFPAPASAPNPLP* |
| Ga0137371_106727741 | 3300012356 | Vadose Zone Soil | RVGRPGVLAYLSDDPDPVAVRLDLRPWGYERLRLVEPGAAGLKPRPDLFPVANPLP* |
| Ga0137384_105054143 | 3300012357 | Vadose Zone Soil | TEDPDPVAVRLDLRPWGGERLALTEEGATGSAPRADLFRSGNPLA* |
| Ga0137361_108008023 | 3300012362 | Vadose Zone Soil | DLRPWGHERLRLAEPGAAGVAPRPDLFPEANPLP* |
| Ga0134058_11910243 | 3300012379 | Grasslands Soil | RPGVLTSLSDDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0134046_11482483 | 3300012386 | Grasslands Soil | LTFLSEDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0134031_12529791 | 3300012388 | Grasslands Soil | EDPDPIAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0134061_12244133 | 3300012399 | Grasslands Soil | LDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0134048_11859571 | 3300012400 | Grasslands Soil | LDLRPWGADRLRLVEPGASGVAPRPDLFPSANPLG* |
| Ga0134041_14187463 | 3300012405 | Grasslands Soil | VAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0134060_14866351 | 3300012410 | Grasslands Soil | EDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0137396_101110241 | 3300012918 | Vadose Zone Soil | DPIAVRLDLRPWGAGRLLLVEPGAAGLAPRSDLFPAANPLP* |
| Ga0137359_104571843 | 3300012923 | Vadose Zone Soil | LAALSADPDPVAIRLDLRPWGAGRLLLVEPEAAGLAPRAELFPAANLLP* |
| Ga0134077_101009033 | 3300012972 | Grasslands Soil | DPDPVAVRLDLRPWAAGRILLVEPGAAGLPPRPDLFPSANPLP* |
| Ga0134079_107561311 | 3300014166 | Grasslands Soil | DLRPWGAGRLLLVEPDATGLAPRSDLFPTANPLP* |
| Ga0137403_112565141 | 3300015264 | Vadose Zone Soil | RPGVLTSLSDDPDPVAVRLDLRPWDAGRVLLVEPGAAGLAPRSDLFPSSNPLP* |
| Ga0134073_100606283 | 3300015356 | Grasslands Soil | LAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG* |
| Ga0134072_100213501 | 3300015357 | Grasslands Soil | RLDVRPWGHDRLRLTEPGGHGLAPRPDLFPESNPLA* |
| Ga0134072_101208803 | 3300015357 | Grasslands Soil | DPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP* |
| Ga0132258_137117101 | 3300015371 | Arabidopsis Rhizosphere | DPVAVRLDLRPWGYERLSLVEPGAAGLAPRGDLFPSGNPLA* |
| Ga0134112_101196414 | 3300017656 | Grasslands Soil | LTALSADPDPVAVRLDLRPWGGERLRLVEPGAVGLAPRSDLFPSANPLP |
| Ga0066669_120519242 | 3300018482 | Grasslands Soil | VHLSDDPDPVAVRLDLRPWGHDRLRLTEPGRHGLAPRPDLFPEANPLA |
| Ga0179596_104917261 | 3300021086 | Vadose Zone Soil | YLSEDPDPVAVRLDLRLWGGERVALVEEGASGLAPRADLFPSATASA |
| Ga0247674_10217463 | 3300024275 | Soil | LDLRPWGYDRLRLVEPGAAGLAPRVDLFVAANPLA |
| Ga0137417_13395412 | 3300024330 | Vadose Zone Soil | LSDDPDPVAVRLDLRPWGASRLLLVEPGAAGLAPRSDLFPAANPLP |
| Ga0209521_101617011 | 3300025164 | Soil | VLVLLTDDPDPVAVRLDLRPWGFDRLKLTEPGAVGLRPRPDLFPSANPLA |
| Ga0209641_101002004 | 3300025322 | Soil | DPVAVRLDLRPWGFDRLKLTEPGAVGLRPRPDLFPSANPLA |
| Ga0207646_101920461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRPGVLALLSDDPDPVAVRLDLRPWGYERLKLAEPGARGLAPRPDLFPPHNPLG |
| Ga0209235_10014001 | 3300026296 | Grasslands Soil | SDDPDPVAVRLDVRPWGHERLRLAEPGARGLAPRPDLFPEANPLA |
| Ga0209235_10339893 | 3300026296 | Grasslands Soil | AVRLDSRPWGADRLRLVEPGASGVAPRPDLFPSANPLG |
| Ga0209238_10262453 | 3300026301 | Grasslands Soil | LSDDPDPVAVRLDLRPWGHERLRLMEPGAAGLAPRPDLFPSANPLG |
| Ga0209238_12108242 | 3300026301 | Grasslands Soil | RLDLRPWGADRLRLIEPGASGGAPRPDLFPSANPLG |
| Ga0209268_10151511 | 3300026314 | Soil | PDPVAVRLDLRPWGAGRLLLVEPDATGLAPRSDLFPTANPLP |
| Ga0209686_10232711 | 3300026315 | Soil | PVAVRLDLRPWGAGRLLLVEPDATGLAPRSDLFPTANPLP |
| Ga0209155_11608401 | 3300026316 | Soil | LSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRSDLFPSGNPLG |
| Ga0209154_10578053 | 3300026317 | Soil | SDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSPNPLG |
| Ga0209687_12943712 | 3300026322 | Soil | VAVRLDLRPWGYERLRLMEPGAAGLAPRSDLFPSGNPLG |
| Ga0209266_10179661 | 3300026327 | Soil | SDDPDPVAVRLDVRPWGHDRLRLTEPGGHGLAPRPDLFPEANPLA |
| Ga0209266_11903021 | 3300026327 | Soil | AVRLDLRPWGAGRVLLVEPGAAGLAPRSDLFPSANPLP |
| Ga0209266_12308491 | 3300026327 | Soil | GDDPDPVTVRLDLRPWGHEPLELAEPDAAGVTPRPDLFPPHNPLG |
| Ga0209267_11102902 | 3300026331 | Soil | LVLLSDDPDPVAVRLDLRPWGAERLRLIEPGAHGAAPRPDLFPSANPLG |
| Ga0209803_10275901 | 3300026332 | Soil | LSDDPDPVAVRLDLRPWGHDRLKLAEPDAAGLAPRPDLFPRHNPLG |
| Ga0209803_11760761 | 3300026332 | Soil | VRLDLRPWGADRLRLVEPGASGVAPRPDLFPSANPLG |
| Ga0209057_12200901 | 3300026342 | Soil | VAVRLDLRPWGADRLRLVEPGGRGVAPRPDLFPSANPLG |
| Ga0209159_11054783 | 3300026343 | Soil | DDPDPVAVRLDLRPWGGDRLALVEEGAAGLPPRADLFPSGKPLA |
| Ga0257166_10581842 | 3300026358 | Soil | HAGRAGVLTSLSDDPDPVAVRLDLRPWGAGRVLLVEPGAAGLAPRADLFPSANPLP |
| Ga0209808_11048591 | 3300026523 | Soil | LAYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG |
| Ga0209807_11427931 | 3300026530 | Soil | GVLAYLSDDPDPVAVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSANPLG |
| Ga0209805_10576261 | 3300026542 | Soil | DDPDPVAVRLDLRPWGAERLRLIEPGAHGAAPRPDLFPSANPLG |
| Ga0209076_11828302 | 3300027643 | Vadose Zone Soil | PVAVRLDLRPWGAERLRLIEPGAHGAAPRPDLFPAANPLG |
| Ga0209588_11102271 | 3300027671 | Vadose Zone Soil | GVLVWLSDDPDPVAVRLDLRPWGHERLRLVEAGGAGLAPRPDLFPSSNPLA |
| Ga0209073_105284121 | 3300027765 | Agricultural Soil | TLSDDPDPVAVRLDLRPWGYERLSLVEPGAAGLAPRGDLFPSGNPLA |
| Ga0209853_10790493 | 3300027961 | Groundwater Sand | DPDPVAVRLDLRPWGFDRLKLTEPGAVGLRPRPDLFPSANPLA |
| Ga0307470_100403154 | 3300032174 | Hardwood Forest Soil | RLDLRPWGYDRLRLVEPGAAGLAPRVDLFVAANPLA |
| Ga0307471_1013927151 | 3300032180 | Hardwood Forest Soil | AVRLDLRPWGYERLRLMEPGAAGLAPRPDLFPSGNPLG |
| ⦗Top⦘ |