


| Basic Information | |
|---|---|
| Family ID | F095853 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRIL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.95 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 95.24 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.619 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF12838 | Fer4_7 | 74.29 |
| PF00037 | Fer4 | 10.48 |
| PF02190 | LON_substr_bdg | 9.52 |
| PF03741 | TerC | 0.95 |
| PF00595 | PDZ | 0.95 |
| PF12007 | DUF3501 | 0.95 |
| PF02754 | CCG | 0.95 |
| PF16881 | LIAS_N | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.95 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.10 % |
| Unclassified | root | N/A | 1.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11573042 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300004479|Ga0062595_101395420 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300004643|Ga0062591_100705907 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300004643|Ga0062591_100909920 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005167|Ga0066672_10177810 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005172|Ga0066683_10214604 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300005177|Ga0066690_10215255 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005180|Ga0066685_10857514 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005206|Ga0068995_10143743 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005328|Ga0070676_11419729 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005331|Ga0070670_100626651 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005332|Ga0066388_101415674 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005332|Ga0066388_102837806 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005332|Ga0066388_104460380 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005440|Ga0070705_100948925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 695 | Open in IMG/M |
| 3300005455|Ga0070663_100632711 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005543|Ga0070672_101183231 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005552|Ga0066701_10185532 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300005553|Ga0066695_10235569 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005568|Ga0066703_10828669 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005713|Ga0066905_100128961 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300005713|Ga0066905_100418764 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005718|Ga0068866_11106521 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005842|Ga0068858_101065378 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300006031|Ga0066651_10012629 | All Organisms → cellular organisms → Bacteria | 3468 | Open in IMG/M |
| 3300006032|Ga0066696_10001704 | All Organisms → cellular organisms → Bacteria | 9521 | Open in IMG/M |
| 3300006175|Ga0070712_100885930 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006797|Ga0066659_11217480 | Not Available | 629 | Open in IMG/M |
| 3300006904|Ga0075424_100214350 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300006904|Ga0075424_101779424 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300007076|Ga0075435_101553282 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009038|Ga0099829_11168305 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009038|Ga0099829_11292788 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009100|Ga0075418_12893738 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009177|Ga0105248_11710405 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010043|Ga0126380_10605219 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010142|Ga0127483_1177031 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010322|Ga0134084_10097641 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300010322|Ga0134084_10121298 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300010335|Ga0134063_10554104 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010398|Ga0126383_11206498 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010400|Ga0134122_10930497 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300011429|Ga0137455_1042356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1276 | Open in IMG/M |
| 3300012351|Ga0137386_10276136 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012398|Ga0134051_1291237 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012929|Ga0137404_10505985 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012958|Ga0164299_10614493 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012972|Ga0134077_10420413 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300015240|Ga0182876_10035573 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300015264|Ga0137403_11013108 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300015374|Ga0132255_103934569 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300016341|Ga0182035_10319205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1280 | Open in IMG/M |
| 3300016422|Ga0182039_11862499 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300016422|Ga0182039_11867256 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300017792|Ga0163161_11286830 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300017973|Ga0187780_11258971 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018060|Ga0187765_11236641 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018064|Ga0187773_10492720 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018431|Ga0066655_10217778 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300018468|Ga0066662_10954292 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10423954 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300024330|Ga0137417_1297997 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300025165|Ga0209108_10481284 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025899|Ga0207642_10861375 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025907|Ga0207645_10366867 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300025910|Ga0207684_10437256 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300025920|Ga0207649_11684863 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025933|Ga0207706_10384485 | Not Available | 1218 | Open in IMG/M |
| 3300026067|Ga0207678_10703147 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300026298|Ga0209236_1248812 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026306|Ga0209468_1201104 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026309|Ga0209055_1227965 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026310|Ga0209239_1261747 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300026317|Ga0209154_1112069 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300026323|Ga0209472_1288382 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026326|Ga0209801_1290565 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026540|Ga0209376_1420539 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027886|Ga0209486_10839257 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027900|Ga0209253_10764134 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10179744 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030336|Ga0247826_10638986 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031368|Ga0307429_1119275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300031543|Ga0318516_10182207 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300031640|Ga0318555_10346874 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031681|Ga0318572_10663852 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031682|Ga0318560_10819691 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031736|Ga0318501_10320437 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031751|Ga0318494_10722506 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031765|Ga0318554_10609924 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031770|Ga0318521_10820049 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031771|Ga0318546_10658909 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031782|Ga0318552_10359158 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031799|Ga0318565_10305626 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031897|Ga0318520_10860315 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031910|Ga0306923_10586377 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300031912|Ga0306921_11485189 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300031954|Ga0306926_12516410 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032010|Ga0318569_10305296 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032035|Ga0310911_10899110 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300032063|Ga0318504_10193957 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300032075|Ga0310890_11856082 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032076|Ga0306924_11894062 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032090|Ga0318518_10048183 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300033487|Ga0316630_10030096 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300034151|Ga0364935_0321304 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.95% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 0.95% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.95% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.95% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015240 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kc | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_115730422 | 3300000891 | Soil | MIFLALWRRGLFRRMDREKLRQFLGFSSDRLALSRRYPLWW |
| Ga0062595_1013954201 | 3300004479 | Soil | VIFLALWRRGLLRRADREKLGYFLGTAGGPLALSRRYPLWRILRP |
| Ga0062591_1007059072 | 3300004643 | Soil | VILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRLGLLHMMVS |
| Ga0062591_1009099201 | 3300004643 | Soil | VIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILR |
| Ga0066672_101778101 | 3300005167 | Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRI |
| Ga0066683_102146041 | 3300005172 | Soil | VILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRILGPMRLLFSPRYAEAVA |
| Ga0066690_102152553 | 3300005177 | Soil | MILLALWRRGLLGRVDGEKLRYFLGRNADPLTLSRRYPLWR |
| Ga0066685_108575142 | 3300005180 | Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRIL |
| Ga0068995_101437431 | 3300005206 | Natural And Restored Wetlands | VIFLALWRRGLLRRADREKLGYFLGTAGGPLALSRHYPLWRILRPIRLLVSPRYAEAVA |
| Ga0070676_114197291 | 3300005328 | Miscanthus Rhizosphere | VILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRLGLLHMMVSPAYAAGVA |
| Ga0070670_1006266513 | 3300005331 | Switchgrass Rhizosphere | VILLALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRT |
| Ga0066388_1014156741 | 3300005332 | Tropical Forest Soil | VILWALWRRGLLRRIDGEKIRFFLGLGGDPLFLSRRFPLWRRLGIARLLV |
| Ga0066388_1028378062 | 3300005332 | Tropical Forest Soil | VILLALWRRGLLQRADREKIALFLGRARDPLQLSRRYPLWRSLGLLRL |
| Ga0066388_1044603801 | 3300005332 | Tropical Forest Soil | VILLELWRRGLLARADREKLRHFVGLARDPLALSRRYPMWRIL |
| Ga0070705_1009489252 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFLALWRRGLLRRIDGEKLRQLLGFSSDRLALSRRYPLWWALGPFML |
| Ga0070663_1006327111 | 3300005455 | Corn Rhizosphere | VILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRRYPLWRILRP |
| Ga0070672_1011832311 | 3300005543 | Miscanthus Rhizosphere | MIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRYPLWW |
| Ga0066701_101855321 | 3300005552 | Soil | VILLALWRRGLFRRLDGEKLRHFLGWHRDPLALSRRYPMWRIL |
| Ga0066695_102355691 | 3300005553 | Soil | VILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRIL |
| Ga0066703_108286691 | 3300005568 | Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRIGRLLI |
| Ga0066905_1001289614 | 3300005713 | Tropical Forest Soil | VIVWALWRRGLLRRIDGEKIRFFLGLGADPLYLSRRYPLWRRLGIARLL |
| Ga0066905_1004187641 | 3300005713 | Tropical Forest Soil | VILLALWRRGLLGRLDGEKMRFFLGRSGDPLALSRRYPMWRILSAVRL |
| Ga0068866_111065211 | 3300005718 | Miscanthus Rhizosphere | VIFLALWRRGLFRRADREKLGYFFGLSPDPLALSRRFPMWRILSVPR |
| Ga0068858_1010653781 | 3300005842 | Switchgrass Rhizosphere | VILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRR |
| Ga0066651_100126291 | 3300006031 | Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRI |
| Ga0066696_100017041 | 3300006032 | Soil | VILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRILDIGRLLV |
| Ga0070712_1008859302 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MILLALWRRGLLRRMDGEKLRQFLGFSQDRLALSRRYPMW |
| Ga0066659_112174801 | 3300006797 | Soil | VILILLWRRGLLRRAGREKLRHFVGLAHDPLALSRRYP |
| Ga0075424_1002143501 | 3300006904 | Populus Rhizosphere | MILLALWRRGLLARLDREKLRQFVGASRDRLALSRRYRLW |
| Ga0075424_1017794242 | 3300006904 | Populus Rhizosphere | VILLALWRRGLLGRIDREKLGYFLGIGGDPLALSRQYPMWRILGVLRLLVDPR |
| Ga0075435_1015532822 | 3300007076 | Populus Rhizosphere | VILVALWRRGLLRRADREKLRHFLGLVGDPLALSRQYPMWRIL |
| Ga0099829_111683051 | 3300009038 | Vadose Zone Soil | VILLTLWRRGLLGRIDREKLGHFLGFGGDALTLSRRYPMWR |
| Ga0099829_112927882 | 3300009038 | Vadose Zone Soil | VILLALWRRGLLRRLDGEKLRHFLGWHRDPLALSRRYPM |
| Ga0075418_128937381 | 3300009100 | Populus Rhizosphere | VIFLALWRRGLLGRADREKILYFLGRGPGPLTLSRRFPMWRILGLGRLICSP |
| Ga0105248_117104052 | 3300009177 | Switchgrass Rhizosphere | MIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRYP |
| Ga0126380_106052191 | 3300010043 | Tropical Forest Soil | VILLALWRRGLLARIDREKLDLFLGRARDPLQLSRRYPPWRRLG |
| Ga0127483_11770312 | 3300010142 | Grasslands Soil | VILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILS |
| Ga0134084_100976411 | 3300010322 | Grasslands Soil | VILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMW |
| Ga0134084_101212981 | 3300010322 | Grasslands Soil | VILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRILDIG |
| Ga0134063_105541041 | 3300010335 | Grasslands Soil | VILLTLWRRGLLGRIDREKLVHFLGFSEDALALSRQYPM |
| Ga0126383_112064981 | 3300010398 | Tropical Forest Soil | VILLALWRRGLLGRIDREKFGYFLGVSGDALTLSRQYPMWRILGVLRLLV |
| Ga0134122_109304971 | 3300010400 | Terrestrial Soil | MIFLALWRRGLLRRIDGEKLRQFVGLSRDRLALSRRYPLW |
| Ga0137455_10423561 | 3300011429 | Soil | VIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRIL |
| Ga0137386_102761361 | 3300012351 | Vadose Zone Soil | VILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRIL |
| Ga0134051_12912373 | 3300012398 | Grasslands Soil | VILVALWRQGLLGRADREKVRHFLGLARDPLALSRRYPMWR |
| Ga0137404_105059851 | 3300012929 | Vadose Zone Soil | VILLALWRRGLLRRADREKLGHFFGASPDPLSLSRRY |
| Ga0164299_106144932 | 3300012958 | Soil | VILLALWRRGLLRRADREKLGHFFGRAPDPLTLSRRY |
| Ga0134077_104204132 | 3300012972 | Grasslands Soil | VILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRIL |
| Ga0182876_100355732 | 3300015240 | Microbial Mat | VILWVLWRRGLLRRFDREKVGFFLGHGADRLDLSRRYPLWRRLGLWHMIRAPA |
| Ga0137403_110131081 | 3300015264 | Vadose Zone Soil | VILLALWRRRLLRRIDAEKLRHFLGRDPDPLTLSRRYPMW |
| Ga0132255_1039345692 | 3300015374 | Arabidopsis Rhizosphere | VILFALWRRGLLRRADGEKLRHFLGIAGDRLTLSRRYPMWRILGPFRL |
| Ga0182035_103192051 | 3300016341 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAYAAGVAR |
| Ga0182039_118624991 | 3300016422 | Soil | VILLALWRRGLLGRIDREKLDLFLGRGRDPLQLSRRY |
| Ga0182039_118672561 | 3300016422 | Soil | VILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVT |
| Ga0163161_112868302 | 3300017792 | Switchgrass Rhizosphere | MIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRDF |
| Ga0187780_112589711 | 3300017973 | Tropical Peatland | MILLALWRRGLLRRLDGEKLRYLLGRADDPLLLSRRYPLWRRLVTLRALCS |
| Ga0187765_112366411 | 3300018060 | Tropical Peatland | VILLALWRRGLLGRADREKLRHFLGIHADPLALSRRYPMWRILRPLRMLLSPRYAAAV |
| Ga0187773_104927202 | 3300018064 | Tropical Peatland | VIFWALWRRGLVQRADGEKLRLFFGLVRDPLALSRRY |
| Ga0066655_102177781 | 3300018431 | Grasslands Soil | VILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRILGPMRLLF |
| Ga0066662_109542921 | 3300018468 | Grasslands Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMW |
| (restricted) Ga0233425_104239541 | 3300024054 | Freshwater | MILLALWRRGLLGRAINAEKLRFFLGIGSDRLLLSRRYPLWRILHPVRLVVS |
| Ga0137417_12979971 | 3300024330 | Vadose Zone Soil | VILIALWRRGLLGRADREKLRHFLGFARDPLTLSRRYPMWRILNPLRLLVRLAALRG |
| Ga0209108_104812841 | 3300025165 | Soil | VILLALWRRGLLRRADRDKLAYFLGLARDPLVLSRRYPMWRILGP |
| Ga0207642_108613751 | 3300025899 | Miscanthus Rhizosphere | VIFLALWRRGLFRRADREKLGYFFGVSPDPLALSRRFPMWRILSVPRLLCSPTYAR |
| Ga0207645_103668671 | 3300025907 | Miscanthus Rhizosphere | VILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRVGL |
| Ga0207684_104372561 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VILLALWRRGLLGRADREKLAHFLGFARDPLTLSRRYPM |
| Ga0207649_116848631 | 3300025920 | Corn Rhizosphere | VIFLALWRRGLFRRADREKLGYFFGLSPDPLALSRRF |
| Ga0207706_103844852 | 3300025933 | Corn Rhizosphere | VILVALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRTLGVVRL |
| Ga0207678_107031472 | 3300026067 | Corn Rhizosphere | VILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRRYPLW |
| Ga0209236_12488121 | 3300026298 | Grasslands Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPM |
| Ga0209468_12011041 | 3300026306 | Soil | VILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILRPLRLLVSPRYAAA |
| Ga0209055_12279651 | 3300026309 | Soil | VILVALWRQGLLGRADREKVRHFLGLARDPLALSRRYPMWRI |
| Ga0209239_12617472 | 3300026310 | Grasslands Soil | VILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILG |
| Ga0209154_11120691 | 3300026317 | Soil | VILVALWRQGLLGRADREKVRHFLGLARDPLALSRR |
| Ga0209472_12883821 | 3300026323 | Soil | VILLALWRRGLFRRLDGEKLRHFLGWHRDPLALSRRYPMWR |
| Ga0209801_12905651 | 3300026326 | Soil | MILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRIGRLLVSPAHARAVAR |
| Ga0209376_14205392 | 3300026540 | Soil | VILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILRPVRLLVSPRY |
| Ga0209486_108392572 | 3300027886 | Agricultural Soil | VIVVALWRRGLFARLDADKLRQFAGLRRDPLALSRRYPMWRALGV |
| Ga0209253_107641342 | 3300027900 | Freshwater Lake Sediment | VILWVLWRRGLLQRFDREKVGFFLGWGADRLDLSRRYPLWRRL |
| (restricted) Ga0233418_101797441 | 3300027995 | Sediment | VILYALWRGGLLGRVNRENLRQFWGLRRDPLLLSRRYPMWRSLGFV |
| Ga0247826_106389861 | 3300030336 | Soil | VIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILRPVRLLLSPRYAESVA |
| Ga0307429_11192751 | 3300031368 | Salt Marsh | VILWALWRRGLLGRVDREKMAFFLGLGRDPLLLSRRYPLWRILGRRGLLASPRR |
| Ga0318516_101822071 | 3300031543 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLS |
| Ga0318555_103468742 | 3300031640 | Soil | VILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVTLRALGS |
| Ga0318572_106638521 | 3300031681 | Soil | VILLALWRRGLLARIDREKLALFLGRARDPLQLSRRYPPWRRLGVFRLLLSPAYAATVDI |
| Ga0318560_108196912 | 3300031682 | Soil | VILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRM |
| Ga0318501_103204372 | 3300031736 | Soil | VILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRMLLSPAY |
| Ga0318494_107225062 | 3300031751 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLR |
| Ga0318554_106099241 | 3300031765 | Soil | VILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVTL |
| Ga0318521_108200491 | 3300031770 | Soil | VILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRMLLSP |
| Ga0318546_106589092 | 3300031771 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGLL |
| Ga0318552_103591582 | 3300031782 | Soil | VILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWR |
| Ga0318565_103056262 | 3300031799 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPP |
| Ga0318520_108603152 | 3300031897 | Soil | VILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAY |
| Ga0306923_105863773 | 3300031910 | Soil | VILLALWRRGLLARIDREKLALFLGRARDPLQLSRRYPPWRRLGVFRLLLSP |
| Ga0306921_114851891 | 3300031912 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRL |
| Ga0306926_125164102 | 3300031954 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGLLRLLLS |
| Ga0318569_103052962 | 3300032010 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAYAAGESR |
| Ga0310911_108991101 | 3300032035 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVFRLLLSPAYAA |
| Ga0318504_101939571 | 3300032063 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLTPAYA |
| Ga0310890_118560821 | 3300032075 | Soil | VIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILRPVRLLLSP |
| Ga0306924_118940621 | 3300032076 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVFRLLLS |
| Ga0318518_100481835 | 3300032090 | Soil | VILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAY |
| Ga0316630_100300965 | 3300033487 | Soil | VILYALWRRGLLRRLDGERLRQFWGWRRDPLLLSRRYPMWRALGLARLLVSP |
| Ga0364935_0321304_2_130 | 3300034151 | Sediment | MILLALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRTL |
| ⦗Top⦘ |