


| Basic Information | |
|---|---|
| Family ID | F095831 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLKLRPAIRYGIDALLILVPLLGMTYFLFDPEAFNAFLAWLARVL |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 20.95 % |
| % of genes near scaffold ends (potentially truncated) | 32.38 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.238 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 5.71 |
| PF12276 | DUF3617 | 3.81 |
| PF00005 | ABC_tran | 3.81 |
| PF07733 | DNA_pol3_alpha | 1.90 |
| PF02687 | FtsX | 0.95 |
| PF04454 | Linocin_M18 | 0.95 |
| PF03459 | TOBE | 0.95 |
| PF13669 | Glyoxalase_4 | 0.95 |
| PF06186 | DUF992 | 0.95 |
| PF02586 | SRAP | 0.95 |
| PF01068 | DNA_ligase_A_M | 0.95 |
| PF12096 | DUF3572 | 0.95 |
| PF12762 | DDE_Tnp_IS1595 | 0.95 |
| PF00144 | Beta-lactamase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 1.90 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 1.90 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.95 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.95 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.95 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.33 % |
| All Organisms | root | All Organisms | 46.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100120041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2475 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10471195 | Not Available | 507 | Open in IMG/M |
| 3300004092|Ga0062389_100339049 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300004092|Ga0062389_101261035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 925 | Open in IMG/M |
| 3300005332|Ga0066388_101969428 | Not Available | 1046 | Open in IMG/M |
| 3300005537|Ga0070730_11074980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → Actinomyces dentalis | 500 | Open in IMG/M |
| 3300005764|Ga0066903_100143572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3404 | Open in IMG/M |
| 3300005764|Ga0066903_102482793 | Not Available | 1003 | Open in IMG/M |
| 3300005764|Ga0066903_102627701 | Not Available | 976 | Open in IMG/M |
| 3300005764|Ga0066903_106511249 | Not Available | 608 | Open in IMG/M |
| 3300006175|Ga0070712_101744766 | Not Available | 545 | Open in IMG/M |
| 3300006176|Ga0070765_101639179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300006845|Ga0075421_102438925 | Not Available | 546 | Open in IMG/M |
| 3300006893|Ga0073928_10014555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8680 | Open in IMG/M |
| 3300006893|Ga0073928_10165270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1770 | Open in IMG/M |
| 3300009100|Ga0075418_12308988 | Not Available | 587 | Open in IMG/M |
| 3300009520|Ga0116214_1134272 | Not Available | 918 | Open in IMG/M |
| 3300009525|Ga0116220_10576005 | Not Available | 516 | Open in IMG/M |
| 3300009553|Ga0105249_10176674 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300009764|Ga0116134_1060293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1429 | Open in IMG/M |
| 3300010360|Ga0126372_12826710 | Not Available | 537 | Open in IMG/M |
| 3300010360|Ga0126372_13238748 | Not Available | 506 | Open in IMG/M |
| 3300010360|Ga0126372_13253429 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010376|Ga0126381_101509346 | Not Available | 971 | Open in IMG/M |
| 3300010376|Ga0126381_102590210 | Not Available | 726 | Open in IMG/M |
| 3300010376|Ga0126381_103386145 | Not Available | 628 | Open in IMG/M |
| 3300010376|Ga0126381_104756150 | Not Available | 522 | Open in IMG/M |
| 3300010379|Ga0136449_101606855 | Not Available | 987 | Open in IMG/M |
| 3300010379|Ga0136449_101702223 | Not Available | 950 | Open in IMG/M |
| 3300010396|Ga0134126_10689874 | Not Available | 1161 | Open in IMG/M |
| 3300010398|Ga0126383_10199229 | Not Available | 1921 | Open in IMG/M |
| 3300010398|Ga0126383_12179597 | Not Available | 641 | Open in IMG/M |
| 3300010398|Ga0126383_12948660 | Not Available | 556 | Open in IMG/M |
| 3300012180|Ga0153974_1077489 | Not Available | 742 | Open in IMG/M |
| 3300012957|Ga0164303_10295019 | Not Available | 953 | Open in IMG/M |
| 3300012971|Ga0126369_12058667 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012980|Ga0168315_119824 | Not Available | 620 | Open in IMG/M |
| 3300012989|Ga0164305_10040572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2643 | Open in IMG/M |
| 3300013296|Ga0157374_12646685 | Not Available | 529 | Open in IMG/M |
| 3300014201|Ga0181537_10570299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 773 | Open in IMG/M |
| 3300015371|Ga0132258_11638881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1623 | Open in IMG/M |
| 3300016270|Ga0182036_10624688 | Not Available | 866 | Open in IMG/M |
| 3300016294|Ga0182041_11172629 | Not Available | 700 | Open in IMG/M |
| 3300016341|Ga0182035_10512857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1025 | Open in IMG/M |
| 3300016404|Ga0182037_12120911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300016422|Ga0182039_10552194 | Not Available | 1001 | Open in IMG/M |
| 3300017943|Ga0187819_10107359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1667 | Open in IMG/M |
| 3300017961|Ga0187778_11107899 | Not Available | 552 | Open in IMG/M |
| 3300017970|Ga0187783_10044488 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
| 3300017970|Ga0187783_10060129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2803 | Open in IMG/M |
| 3300017970|Ga0187783_10598923 | Not Available | 797 | Open in IMG/M |
| 3300017970|Ga0187783_10617090 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300017972|Ga0187781_10119340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa → Microcystis aeruginosa Ma_OC_H_19870700_S124 | 1838 | Open in IMG/M |
| 3300017972|Ga0187781_10273855 | Not Available | 1196 | Open in IMG/M |
| 3300017972|Ga0187781_10857666 | Not Available | 660 | Open in IMG/M |
| 3300017975|Ga0187782_10027608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4132 | Open in IMG/M |
| 3300017975|Ga0187782_11138103 | Not Available | 610 | Open in IMG/M |
| 3300017975|Ga0187782_11276637 | Not Available | 576 | Open in IMG/M |
| 3300018001|Ga0187815_10106028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1186 | Open in IMG/M |
| 3300018044|Ga0187890_10790075 | Not Available | 537 | Open in IMG/M |
| 3300018062|Ga0187784_10250056 | Not Available | 1443 | Open in IMG/M |
| 3300020579|Ga0210407_10136136 | Not Available | 1887 | Open in IMG/M |
| 3300020582|Ga0210395_10164275 | Not Available | 1660 | Open in IMG/M |
| 3300020582|Ga0210395_11087296 | Not Available | 590 | Open in IMG/M |
| 3300021168|Ga0210406_10576890 | Not Available | 881 | Open in IMG/M |
| 3300021171|Ga0210405_10406512 | Not Available | 1072 | Open in IMG/M |
| 3300021171|Ga0210405_11135906 | Not Available | 582 | Open in IMG/M |
| 3300021180|Ga0210396_11560447 | Not Available | 541 | Open in IMG/M |
| 3300021405|Ga0210387_10961713 | Not Available | 749 | Open in IMG/M |
| 3300021477|Ga0210398_10019102 | All Organisms → cellular organisms → Bacteria | 5873 | Open in IMG/M |
| 3300021477|Ga0210398_11261169 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021560|Ga0126371_12379840 | Not Available | 640 | Open in IMG/M |
| 3300022557|Ga0212123_10434819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 869 | Open in IMG/M |
| 3300022557|Ga0212123_10445612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 855 | Open in IMG/M |
| 3300025320|Ga0209171_10415410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 686 | Open in IMG/M |
| 3300025939|Ga0207665_10995870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 667 | Open in IMG/M |
| 3300027684|Ga0209626_1138538 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027895|Ga0209624_11004434 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027908|Ga0209006_10033767 | All Organisms → cellular organisms → Bacteria | 4632 | Open in IMG/M |
| 3300027908|Ga0209006_10059693 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
| 3300027915|Ga0209069_10803724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300029636|Ga0222749_10157699 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300030707|Ga0310038_10031237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3177 | Open in IMG/M |
| 3300031090|Ga0265760_10052013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
| 3300031090|Ga0265760_10365352 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031573|Ga0310915_10251056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1245 | Open in IMG/M |
| 3300031573|Ga0310915_10417898 | Not Available | 953 | Open in IMG/M |
| 3300031715|Ga0307476_10996897 | Not Available | 617 | Open in IMG/M |
| 3300031744|Ga0306918_10215243 | Not Available | 1454 | Open in IMG/M |
| 3300031910|Ga0306923_11358000 | Not Available | 751 | Open in IMG/M |
| 3300031912|Ga0306921_11052434 | Not Available | 915 | Open in IMG/M |
| 3300031912|Ga0306921_11379984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 776 | Open in IMG/M |
| 3300031912|Ga0306921_11462273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 749 | Open in IMG/M |
| 3300031941|Ga0310912_10864749 | Not Available | 697 | Open in IMG/M |
| 3300031954|Ga0306926_12091103 | Not Available | 634 | Open in IMG/M |
| 3300032001|Ga0306922_12154552 | Not Available | 539 | Open in IMG/M |
| 3300032076|Ga0306924_11438959 | Not Available | 734 | Open in IMG/M |
| 3300032076|Ga0306924_11723970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300032160|Ga0311301_10008034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 34992 | Open in IMG/M |
| 3300032261|Ga0306920_100739977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1447 | Open in IMG/M |
| 3300032261|Ga0306920_101165872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
| 3300032515|Ga0348332_11980149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300032805|Ga0335078_11846580 | Not Available | 655 | Open in IMG/M |
| 3300032892|Ga0335081_10199694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2770 | Open in IMG/M |
| 3300033402|Ga0326728_10000046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 477730 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.95% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012980 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001200416 | 3300002245 | Forest Soil | MPAVRTIVRYAIDALLIFAPLSGMMYFLFNPDAFNAFLAWLVGVL* |
| JGIcombinedJ51221_104711951 | 3300003505 | Forest Soil | MPKIPPAVRYTLDALLIVVPLILMTYFLFDPAAFNAFTAWLARVL* |
| Ga0062389_1003390492 | 3300004092 | Bog Forest Soil | MPAPRTIVKYAIDVLLIFAPLSGVMYFLFDPDAFNVFLAWLVRVL* |
| Ga0062389_1012610353 | 3300004092 | Bog Forest Soil | MPAARTIVRYAIDALLIFAPLSGVMYFLFNPDAFNAFLAWLVGVL* |
| Ga0066388_1019694282 | 3300005332 | Tropical Forest Soil | VDIGVKVMPTAIKHSVDILLIAVPLFVMTYFLFNPAAFNAFTDWLARTL* |
| Ga0070730_110749801 | 3300005537 | Surface Soil | MLKLRPAIRYGIDALLILVPLLGMMYFLFDPEAFNAFLAWLARVL* |
| Ga0066903_1001435723 | 3300005764 | Tropical Forest Soil | MPKLRPAIRYGIDAVLILAPLLGMTYLLFNPAAFNAWLAWLARML* |
| Ga0066903_1024827932 | 3300005764 | Tropical Forest Soil | MTAAVRYTLDTLLIMVPLIVMTYFVFDPAAFNVFTGWLARVL* |
| Ga0066903_1026277012 | 3300005764 | Tropical Forest Soil | MTAAVRYTLDTLLVIVPLTVMTYFLFDPSAFNAFTAWLIRVL* |
| Ga0066903_1065112492 | 3300005764 | Tropical Forest Soil | VRYTLDTLLIMVPLTVMTFFLFDPAAFNLFTGWLARVL* |
| Ga0070712_1017447661 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GAMAKGWKAVRYGVDALLILVPLSGMTYFLFYPDAFNAVLAWLAHVL* |
| Ga0070765_1016391792 | 3300006176 | Soil | MLRPAFKYGIDAILILVPLGGMTYFLFDPDAFNAFL |
| Ga0075421_1024389252 | 3300006845 | Populus Rhizosphere | MAKGWKAVRYGVDALLILVPLSGMTYFLFYPDAFNAVLAWLAHVL* |
| Ga0073928_100145555 | 3300006893 | Iron-Sulfur Acid Spring | MPAARTIVKYTIDVLLIFVPLAGVIYFLFEPDAFNAFLAWLVRVL* |
| Ga0073928_101652704 | 3300006893 | Iron-Sulfur Acid Spring | MPAVRTIAKYAIDALLIFAPLSGVMYFLFNPDAFNAFLAWLVGVL* |
| Ga0075418_123089882 | 3300009100 | Populus Rhizosphere | MAKLPPAARYTLDALLIVVPLIVMTYFLFDPAAFNAFTAWLARVL* |
| Ga0116214_11342722 | 3300009520 | Peatlands Soil | MPPVRTMVKYAIDALLIFAPLCGVMYFLFNPDAFNAFLAWLARVL* |
| Ga0116220_105760051 | 3300009525 | Peatlands Soil | TMVKYAIDALLIFAPLCGVMYFLFDPDAFNAFLAWLARVL* |
| Ga0105249_101766746 | 3300009553 | Switchgrass Rhizosphere | GLFIRRPLSPMAKLPPAARYTLDALLIVVPLIVMTYFLFDPAAFNAFTAWLARVL* |
| Ga0116134_10602932 | 3300009764 | Peatland | MPPRQIIKYAIDIVLVVAPLSGILYFLFDPDAFNAFLDWIVRAL* |
| Ga0126372_128267101 | 3300010360 | Tropical Forest Soil | IKYGIDALLVAVPLLGMTYFLFDPEAFNAFTAWLVRVL* |
| Ga0126372_132387481 | 3300010360 | Tropical Forest Soil | TAAVRYTLDTLLIMVPLIVMTYFVFDPAAFNVFTGWLARVL* |
| Ga0126372_132534291 | 3300010360 | Tropical Forest Soil | MMPAAVKHTVDILLVAVPLFVMTYFLFNPAAFNAFTAWLARTL* |
| Ga0126381_1015093461 | 3300010376 | Tropical Forest Soil | MTAVVRYTLDTLLIMVPLTVMTFFLFDPAAFNLFTGWLASVL* |
| Ga0126381_1025902101 | 3300010376 | Tropical Forest Soil | LRPAIKYGIDTLLVAVPLFGMTYFLFDPEAFNAVTAWLVRVL* |
| Ga0126381_1033861452 | 3300010376 | Tropical Forest Soil | MTAAVRYALDTLLVVVPLIVMTYFLFDPAAFNLFTGWLARVL* |
| Ga0126381_1047561502 | 3300010376 | Tropical Forest Soil | MPKIPPAVRYTLDALLIAVPLILMTYFLFDPAAFNAFTAWLARVL* |
| Ga0136449_1016068552 | 3300010379 | Peatlands Soil | MPPARTMVKYAIDALLIFAPLCGVMYFLFNPDAFNAFLAWLARVL* |
| Ga0136449_1017022231 | 3300010379 | Peatlands Soil | MLKLRPAIRYGIDALLILVPLLGMTYFLFDPEAFNAFLAWLARVL* |
| Ga0134126_106898741 | 3300010396 | Terrestrial Soil | MAKGWKAVRYGVDALLILVPLSGMTYFLFYLDAFNAVLARLAHVL* |
| Ga0126383_101992294 | 3300010398 | Tropical Forest Soil | MPKMRPAIRYGIDALLILIPLLVMTYFLFYPEAFNACLAWLATVL* |
| Ga0126383_121795971 | 3300010398 | Tropical Forest Soil | KLRPAIKYGIDTLLVAVPLLGMTYFLFDPEAFNAFTAWLMRVV* |
| Ga0126383_129486601 | 3300010398 | Tropical Forest Soil | IDALLIVVPLFGMTYFLFDPEAFNGVTAWLCRVL* |
| Ga0153974_10774892 | 3300012180 | Attine Ant Fungus Gardens | MPKVRTAVRYGIEALLILVPLSGMTYFLFDPDAFNAFLAWLAKVL* |
| Ga0164303_102950191 | 3300012957 | Soil | MQKMPPAIRYGIDALLILVPLDAMTYFLSDPAAFNAFAAWLARVL* |
| Ga0126369_120586671 | 3300012971 | Tropical Forest Soil | MPAAVKHTVDILLIALPLFVMTYFLFNPAAFDAFTAWLARTL* |
| Ga0168315_1198241 | 3300012980 | Weathered Mine Tailings | AAMPRLPPAIGYGIDAVLILVPLLGMTYFLFNPAAFNAFLAWLVRVL* |
| Ga0164305_100405726 | 3300012989 | Soil | MPKLRLAIRYGIDALLILIPLLGMTYFLFDPEAFNAFLAWLARIL* |
| Ga0157374_126466851 | 3300013296 | Miscanthus Rhizosphere | MPKLPPAIRYGIDAVLILVPLLGMTYFLFNPAAFNAFTAWLARVL* |
| Ga0181537_105702993 | 3300014201 | Bog | MPARRIVKYAFDVLLIFAPLAAVIYFLFNPDAFNAFSAWLVRVL* |
| Ga0132258_116388811 | 3300015371 | Arabidopsis Rhizosphere | VEVMPATVKHTVDILLIAVPLFVMTYFLFNPAAFNAFTAWLARTL* |
| Ga0182036_106246881 | 3300016270 | Soil | MSPPRMIVKYTIDLLLIFVPLAAVTYFLFNPSAFNAFTAWLAHVL |
| Ga0182041_111726292 | 3300016294 | Soil | MPKLRPAIRYGIDAVLILALLLGMTYFSIKPVAFNAWLAWLARML |
| Ga0182035_105128571 | 3300016341 | Soil | MTAALRYTLDTLLITVPLIVMTSFLFDPAAFNLFTAWLARVV |
| Ga0182037_121209112 | 3300016404 | Soil | KYGIDALLVAVPLLGMTYFLFEPEAFNAFTAWLVRVL |
| Ga0182039_105521942 | 3300016422 | Soil | MPKMRPAIRYGIDALLILIPLLVMTYFLFYPEAFNACLAWLATVL |
| Ga0187819_101073592 | 3300017943 | Freshwater Sediment | MPPARTIVKYAIDALLIFAPLCGVMYFLFDPDAFNAFLAWLARVL |
| Ga0187778_111078992 | 3300017961 | Tropical Peatland | MAEPRKIVQHTLDAVLIFAPLSGMLYFLFDSAAFNAFLAWLLSVL |
| Ga0187783_100444883 | 3300017970 | Tropical Peatland | MPEPRKVIKYTFDAALIFAPLSGMLYFLFDPAAFNAFLAWLVSVL |
| Ga0187783_100601291 | 3300017970 | Tropical Peatland | TRDTLLVIVPLTVMTYFLFDPSAFNAFTAWLTRVL |
| Ga0187783_105989232 | 3300017970 | Tropical Peatland | MPKGWTAVRYAIDALLILVPLSGMLYFLFDPDAFNACLRWLAQVL |
| Ga0187783_106170903 | 3300017970 | Tropical Peatland | MPEPRKIMRYTLDAALIFAPLTGMLYFLFDPAAFNAFLAWLVSVL |
| Ga0187781_101193402 | 3300017972 | Tropical Peatland | MAVGVRYTVDMLLVGVPLLVMTYFLFDPAAFNAFTAWLARTL |
| Ga0187781_102738553 | 3300017972 | Tropical Peatland | MPKGWTAVRYAIDALLIAVPLCGMLYFLFNPDAFNACLRWLAKVL |
| Ga0187781_108576662 | 3300017972 | Tropical Peatland | GDPGESGDIRGMSKLPPAVRYGIDPLLILVPLGAMTFFLFDTAAFNAFTAWLAKIL |
| Ga0187782_100276085 | 3300017975 | Tropical Peatland | MPEGWTAVRYAIDALLIAVPLCGMLYFLFNPDAFNACLRWLAKVL |
| Ga0187782_111381032 | 3300017975 | Tropical Peatland | MLKIRQAIKYGIDVLLILVPLCGTMYFLFNPASFNAFLAWLVEVL |
| Ga0187782_112766372 | 3300017975 | Tropical Peatland | MSKLRPAIRYGIEALLILVPLCGMMYFLFNPDDFNRSLAWLMRVL |
| Ga0187815_101060284 | 3300018001 | Freshwater Sediment | MPPARTIVKYAIDALLIFAPLCGVMYFLFDPDAFNAFLAWLTRVL |
| Ga0187890_107900752 | 3300018044 | Peatland | MPSRQIIKYAIDIVLVVAPLAGILYFLFDPDAFNAFLDWLMR |
| Ga0187784_102500561 | 3300018062 | Tropical Peatland | QSDHIWPMLKIRQAIKYGIDVLLILVPLCGTLYFLFNPASFNAFLAWLVEVL |
| Ga0210407_101361361 | 3300020579 | Soil | MQKMPPAIRYGIDALLILVPLDAMTYFLSDPAAFNAFAAWLARVL |
| Ga0210395_101642751 | 3300020582 | Soil | MLRPAFKYGIDAVLILVPLGGMTYFLFDPDAFNAFLDWLMRLF |
| Ga0210395_110872962 | 3300020582 | Soil | RPAFKYGIDAVLILVPLGGMTYFLFDPDAFNAFLDWLMRLF |
| Ga0210406_105768902 | 3300021168 | Soil | MQKMLPAIRYGIDALLILVPLDAMTYFLSDPAAFNAFAAWLARVL |
| Ga0210405_104065123 | 3300021171 | Soil | MPKIPPAVRYTLDALLIVVPLILMTYFLFDPAAFNA |
| Ga0210405_111359062 | 3300021171 | Soil | MSKEMRPAIRYGIEALLILIPLLVMTYFLFYPDAFNMCLAWLAKVL |
| Ga0210396_115604472 | 3300021180 | Soil | PSESVDIGRTRKMPPAIRYGIDALLILVPLVVLMYFLFDPAAFNAFTAWLARVL |
| Ga0210387_109617132 | 3300021405 | Soil | KMPPAIRYGIDALLILVPLDAMTYFLSDPAAFNAFAAWLARVL |
| Ga0210398_100191025 | 3300021477 | Soil | MPEPRKVIRYTLDAALIFAPLSGMLYFLFDPAAFNAFLAWLVSVL |
| Ga0210398_112611691 | 3300021477 | Soil | RPAIRYGIDALLILIPLLGMTYFLFDPEAFNAFLAWLARIL |
| Ga0126371_123798402 | 3300021560 | Tropical Forest Soil | IGNEPVPRIGGEVMTAVVRYTLDTLLIMVPLTVMTFFLFDPAAFNLFTGWLARVL |
| Ga0212123_104348192 | 3300022557 | Iron-Sulfur Acid Spring | MPAARTIVKYTIDVLVIFVPLAGVIYFLFEPDAFNAFLAWLVRVL |
| Ga0212123_104456122 | 3300022557 | Iron-Sulfur Acid Spring | MPAVRTIAKYAIDALLIFAPLSGVMYFLFNPDAFNAFLAWLVGVL |
| Ga0209171_104154102 | 3300025320 | Iron-Sulfur Acid Spring | MPAARTIVKYTIDVLLIFVPLAGVIYFLFEPDAFNAFLAWLVRVL |
| Ga0207665_109958702 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPAIRYGIDALLILVPLDAMTYFLSDPAAFNAFAAWLAR |
| Ga0209626_11385381 | 3300027684 | Forest Soil | VIKSGPLMLRPAFKYGIDAALILVPLGGMTYFVFDPDAFNAFLDWLMRLL |
| Ga0209624_110044342 | 3300027895 | Forest Soil | MLKLRPAIRYGIDALLILVPLLGMTYFLFDPEAFNAFLAWLARIL |
| Ga0209006_100337675 | 3300027908 | Forest Soil | MPAVRTIVRYAIDALLIFAPLSGMMYFLFNPDAFNAFLAWLVGVL |
| Ga0209006_100596933 | 3300027908 | Forest Soil | MLRPAFKYGIDAILILVPLGGMTYFLFDPDAFNAFLDWLMRLF |
| Ga0209069_108037242 | 3300027915 | Watersheds | MLKLRPAIRYGIDALLILVPLLGMMYFLFDPEAFNAFLAWLARVL |
| Ga0222749_101576994 | 3300029636 | Soil | RPAIRYGIDALLILIPLLGMTYFLFDPDAFNAFLAWLARIL |
| Ga0310038_100312374 | 3300030707 | Peatlands Soil | MVKYAIDALLIFAPLCGVMYFLFNPDAFNAFLAWLARVL |
| Ga0265760_100520133 | 3300031090 | Soil | LRPAFKYGIDAVLILVPLGGMTYFLFDPDAFNAFLDWLMRLF |
| Ga0265760_103653522 | 3300031090 | Soil | ILAPMPKLRPAIRYGIDALLILIPLLGMTYFLFDPEAFNAFLAWLARIL |
| Ga0310915_102510562 | 3300031573 | Soil | MTAALRYTLDTLLIIVPLIVMTYFLFDPAAFNLFTAWLARVV |
| Ga0310915_104178981 | 3300031573 | Soil | ILRLMPKLRPAIRYGIDAVLILALLLGMTYFSIKPVAFNAWLA |
| Ga0307476_109968971 | 3300031715 | Hardwood Forest Soil | SMSKEMRPAIRYGIEALLILIPLLVMTYFLFYPDAFNMCLAWLAKVL |
| Ga0306918_102152433 | 3300031744 | Soil | MPKMGPSIRYGIEALLILIPLLLMTYFLFYPDAFNACLAWLARVL |
| Ga0306923_113580002 | 3300031910 | Soil | MTAAVRYTLDTLLIVVPLTVMTFFLFDPAAFNLFTGWLARVL |
| Ga0306921_110524341 | 3300031912 | Soil | MTAAVRYTLDTLLIVVPPTVMTFFLFDPAAFNLFTGWLARVL |
| Ga0306921_113799842 | 3300031912 | Soil | CSAHWEMTAALRYTLDTLLIIVPLIVMTYFLFDPAAFNLFTAWLARVV |
| Ga0306921_114622732 | 3300031912 | Soil | MTAAVRYMLDTLLIMVPLIVMTYFLFDPTAFSHLARRSRT |
| Ga0310912_108647491 | 3300031941 | Soil | GPSIRYGIEALLILIPLLLMTYFLFYPDAFNACLAWLARLL |
| Ga0306926_120911031 | 3300031954 | Soil | AVPRIGGEVMTAAVRYTLDTLLIVVPLTVMTFFLFDPAAFNLFTGWLARVL |
| Ga0306922_121545521 | 3300032001 | Soil | TLDTLLIVVPPTVMTFFLFDPAAFNLFTGWLARVL |
| Ga0306924_114389592 | 3300032076 | Soil | MPKLRPAIRYGIDAVLILAPLLGMTYFLFNPAAFNAWLAWLARML |
| Ga0306924_117239702 | 3300032076 | Soil | MTAAFRYTRDTLLIIVPLCVMTYFLFDPAAFNFLTAWLARVL |
| Ga0311301_1000803440 | 3300032160 | Peatlands Soil | MPPVRTMVKYAIDALLIFAPLCGVMYFLFNPDAFNAFLAWLARVL |
| Ga0306920_1007399772 | 3300032261 | Soil | TLDTLLIIVLLIVMTYFLFDPAAFNLFTAWLARVV |
| Ga0306920_1011658722 | 3300032261 | Soil | MTTAVRYTLDTLLIMVPLTVMTCFLFDPAAFNLFTGWLARVL |
| Ga0348332_119801493 | 3300032515 | Plant Litter | LRKVIRYTLDAALIFAPLSGMLYFLFDPAAFNAFLAWLVSVL |
| Ga0335078_118465802 | 3300032805 | Soil | MPKLPPAVRYGIDAVLILVPLLGMTYFLFNPAAFNAFTAWLARVL |
| Ga0335081_101996941 | 3300032892 | Soil | MPEPRKVIRYTLEAALIFVPLAGMLYFLFDPAAFNAFLA |
| Ga0326728_1000004627 | 3300033402 | Peat Soil | MPPRQTIKYAIDCVLVIAPLSGVLYFLFDPDAFNAFLDWLLRVL |
| ⦗Top⦘ |