


| Basic Information | |
|---|---|
| Family ID | F095793 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MCGRYRRTTSEEELARLYHIPIPKQTDLPISYNIAPSQKVLTI |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 88.57 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.095 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.524 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.31% β-sheet: 0.00% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 2.86 |
| PF00216 | Bac_DNA_binding | 2.86 |
| PF16576 | HlyD_D23 | 1.90 |
| PF01980 | TrmO | 1.90 |
| PF13592 | HTH_33 | 0.95 |
| PF05721 | PhyH | 0.95 |
| PF04542 | Sigma70_r2 | 0.95 |
| PF04493 | Endonuclease_5 | 0.95 |
| PF01832 | Glucosaminidase | 0.95 |
| PF01740 | STAS | 0.95 |
| PF13377 | Peripla_BP_3 | 0.95 |
| PF01471 | PG_binding_1 | 0.95 |
| PF00239 | Resolvase | 0.95 |
| PF01381 | HTH_3 | 0.95 |
| PF14023 | DUF4239 | 0.95 |
| PF01022 | HTH_5 | 0.95 |
| PF04679 | DNA_ligase_A_C | 0.95 |
| PF00069 | Pkinase | 0.95 |
| PF13676 | TIR_2 | 0.95 |
| PF13557 | Phenol_MetA_deg | 0.95 |
| PF00657 | Lipase_GDSL | 0.95 |
| PF01068 | DNA_ligase_A_M | 0.95 |
| PF13193 | AMP-binding_C | 0.95 |
| PF01527 | HTH_Tnp_1 | 0.95 |
| PF13492 | GAF_3 | 0.95 |
| PF01051 | Rep_3 | 0.95 |
| PF08378 | NERD | 0.95 |
| PF10459 | Peptidase_S46 | 0.95 |
| PF03976 | PPK2 | 0.95 |
| PF00891 | Methyltransf_2 | 0.95 |
| PF00106 | adh_short | 0.95 |
| PF13561 | adh_short_C2 | 0.95 |
| PF00534 | Glycos_transf_1 | 0.95 |
| PF00583 | Acetyltransf_1 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 2.86 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.90 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.95 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.95 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.95 |
| COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.95 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.95 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.95 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.95 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.95 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.95 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.10 % |
| All Organisms | root | All Organisms | 41.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100324943 | Not Available | 541 | Open in IMG/M |
| 3300000789|JGI1027J11758_12740049 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1048819 | Not Available | 597 | Open in IMG/M |
| 3300000955|JGI1027J12803_108561543 | Not Available | 1379 | Open in IMG/M |
| 3300004152|Ga0062386_100869355 | Not Available | 744 | Open in IMG/M |
| 3300004152|Ga0062386_101256052 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005187|Ga0066675_10511734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 898 | Open in IMG/M |
| 3300005332|Ga0066388_100886353 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300005445|Ga0070708_100367663 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005445|Ga0070708_102027841 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005467|Ga0070706_100290933 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300005467|Ga0070706_100674391 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005536|Ga0070697_100012919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6542 | Open in IMG/M |
| 3300005536|Ga0070697_100159116 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300005540|Ga0066697_10653936 | Not Available | 578 | Open in IMG/M |
| 3300005610|Ga0070763_10328760 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005610|Ga0070763_10349880 | Not Available | 822 | Open in IMG/M |
| 3300005610|Ga0070763_10543589 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005764|Ga0066903_103564251 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005921|Ga0070766_10078813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1913 | Open in IMG/M |
| 3300006176|Ga0070765_100709690 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300010046|Ga0126384_11042913 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300010047|Ga0126382_11640348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaU1.Bin050 | 598 | Open in IMG/M |
| 3300010360|Ga0126372_12696924 | Not Available | 549 | Open in IMG/M |
| 3300010361|Ga0126378_10353256 | Not Available | 1580 | Open in IMG/M |
| 3300010376|Ga0126381_105029939 | Not Available | 507 | Open in IMG/M |
| 3300012202|Ga0137363_10309437 | Not Available | 1299 | Open in IMG/M |
| 3300012202|Ga0137363_11150758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300012205|Ga0137362_10952271 | Not Available | 732 | Open in IMG/M |
| 3300012205|Ga0137362_11149864 | Not Available | 659 | Open in IMG/M |
| 3300012351|Ga0137386_11166210 | Not Available | 541 | Open in IMG/M |
| 3300012361|Ga0137360_10027222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3909 | Open in IMG/M |
| 3300012361|Ga0137360_10393415 | Not Available | 1167 | Open in IMG/M |
| 3300012361|Ga0137360_10723626 | Not Available | 855 | Open in IMG/M |
| 3300012361|Ga0137360_11262426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012362|Ga0137361_10856131 | Not Available | 826 | Open in IMG/M |
| 3300012929|Ga0137404_10944578 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012960|Ga0164301_10409400 | Not Available | 952 | Open in IMG/M |
| 3300013308|Ga0157375_12201348 | Not Available | 657 | Open in IMG/M |
| 3300016270|Ga0182036_10318594 | Not Available | 1188 | Open in IMG/M |
| 3300016294|Ga0182041_10369270 | Not Available | 1212 | Open in IMG/M |
| 3300016319|Ga0182033_10747041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 859 | Open in IMG/M |
| 3300016357|Ga0182032_10656496 | Not Available | 877 | Open in IMG/M |
| 3300016357|Ga0182032_11913963 | Not Available | 519 | Open in IMG/M |
| 3300016371|Ga0182034_10556327 | Not Available | 963 | Open in IMG/M |
| 3300016445|Ga0182038_10495184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1042 | Open in IMG/M |
| 3300016445|Ga0182038_10672141 | Not Available | 900 | Open in IMG/M |
| 3300018034|Ga0187863_10021477 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
| 3300020579|Ga0210407_11261122 | Not Available | 554 | Open in IMG/M |
| 3300020581|Ga0210399_11339298 | Not Available | 562 | Open in IMG/M |
| 3300020582|Ga0210395_10141834 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300020583|Ga0210401_10988447 | Not Available | 700 | Open in IMG/M |
| 3300021171|Ga0210405_10101350 | Not Available | 2272 | Open in IMG/M |
| 3300021171|Ga0210405_10644258 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300021178|Ga0210408_10708951 | Not Available | 792 | Open in IMG/M |
| 3300021178|Ga0210408_11236873 | Not Available | 569 | Open in IMG/M |
| 3300021361|Ga0213872_10016718 | Not Available | 3402 | Open in IMG/M |
| 3300021361|Ga0213872_10094885 | Not Available | 1332 | Open in IMG/M |
| 3300021361|Ga0213872_10347542 | Not Available | 609 | Open in IMG/M |
| 3300021403|Ga0210397_10454990 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300021403|Ga0210397_10964495 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021405|Ga0210387_10005372 | All Organisms → cellular organisms → Bacteria | 9799 | Open in IMG/M |
| 3300021444|Ga0213878_10478256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300021478|Ga0210402_11762198 | Not Available | 545 | Open in IMG/M |
| 3300021559|Ga0210409_10903353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300021560|Ga0126371_11828426 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300025320|Ga0209171_10339623 | Not Available | 788 | Open in IMG/M |
| 3300025910|Ga0207684_11028229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium LW23 | 688 | Open in IMG/M |
| 3300025916|Ga0207663_11176479 | Not Available | 617 | Open in IMG/M |
| 3300025916|Ga0207663_11256358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 596 | Open in IMG/M |
| 3300025922|Ga0207646_10704519 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025922|Ga0207646_11407843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300026496|Ga0257157_1093972 | Not Available | 523 | Open in IMG/M |
| 3300026557|Ga0179587_10295626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1043 | Open in IMG/M |
| 3300026999|Ga0207949_1009278 | Not Available | 889 | Open in IMG/M |
| 3300027521|Ga0209524_1048977 | Not Available | 891 | Open in IMG/M |
| 3300027583|Ga0209527_1075390 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300027651|Ga0209217_1192452 | Not Available | 551 | Open in IMG/M |
| 3300027727|Ga0209328_10156834 | Not Available | 691 | Open in IMG/M |
| 3300027812|Ga0209656_10301439 | Not Available | 741 | Open in IMG/M |
| 3300027889|Ga0209380_10705030 | Not Available | 579 | Open in IMG/M |
| 3300027895|Ga0209624_10484024 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300029636|Ga0222749_10436758 | Not Available | 699 | Open in IMG/M |
| 3300031708|Ga0310686_106667867 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
| 3300031744|Ga0306918_10644121 | Not Available | 830 | Open in IMG/M |
| 3300031753|Ga0307477_10533097 | Not Available | 796 | Open in IMG/M |
| 3300031771|Ga0318546_11292844 | Not Available | 512 | Open in IMG/M |
| 3300031833|Ga0310917_10160372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1489 | Open in IMG/M |
| 3300031890|Ga0306925_10395521 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300031890|Ga0306925_11723261 | Not Available | 604 | Open in IMG/M |
| 3300031912|Ga0306921_10284539 | Not Available | 1936 | Open in IMG/M |
| 3300031912|Ga0306921_11850918 | Not Available | 647 | Open in IMG/M |
| 3300031942|Ga0310916_10457248 | Not Available | 1087 | Open in IMG/M |
| 3300031945|Ga0310913_10798411 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 666 | Open in IMG/M |
| 3300031954|Ga0306926_12046379 | Not Available | 642 | Open in IMG/M |
| 3300031962|Ga0307479_10686111 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031962|Ga0307479_12016794 | Not Available | 526 | Open in IMG/M |
| 3300032001|Ga0306922_10858254 | Not Available | 945 | Open in IMG/M |
| 3300032076|Ga0306924_11215237 | Not Available | 815 | Open in IMG/M |
| 3300032160|Ga0311301_11719690 | Not Available | 753 | Open in IMG/M |
| 3300032205|Ga0307472_100403530 | Not Available | 1144 | Open in IMG/M |
| 3300032261|Ga0306920_101112943 | Not Available | 1145 | Open in IMG/M |
| 3300032261|Ga0306920_101125920 | Not Available | 1137 | Open in IMG/M |
| 3300032955|Ga0335076_10137241 | Not Available | 2365 | Open in IMG/M |
| 3300033289|Ga0310914_10770892 | Not Available | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1003249431 | 3300000364 | Soil | MCGRYRRTTREKELARIYRIAIPVQLDLPISYNIPLASQ |
| JGI1027J11758_127400491 | 3300000789 | Soil | MCGRYRRTSSEEELCRLYNIPIPPQLDLPVSYNIAPSQKVLAIRFNLKTN |
| AP72_2010_repI_A100DRAFT_10488192 | 3300000837 | Forest Soil | MCGHYRRTTQEEELARLYHIPIPKQTDLPISYNVAP |
| JGI1027J12803_1085615433 | 3300000955 | Soil | MCGRYRRTASEEEAARLYHIPIPSQTDLPLSYLAIV |
| Ga0062386_1008693551 | 3300004152 | Bog Forest Soil | IRQNPHIRMCGRRTTQEEELARIYHIPIPKQTDLPISYNIAPSQNVLTIQFNSETQQRSLDALQGD* |
| Ga0062386_1012560522 | 3300004152 | Bog Forest Soil | GRYRRTTKEEELARIYNIPIPEQPDLPVSYNIAPSQDILAIRFNPETGERC* |
| Ga0066675_105117341 | 3300005187 | Soil | MCGRYRRTTQEEELARLYHIPIPKQPDLPISYNIAPSQKVLAIRF |
| Ga0066388_1008863534 | 3300005332 | Tropical Forest Soil | MEKIVMCGRYRRTTSEEELARLYHIPIPPQRDLPISWNIAP |
| Ga0070708_1003676631 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPRQTDLPISYNIAPSQKVLTIRFNRETQQR |
| Ga0070708_1020278412 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPKQTNLPISYNIAPSQKVLTIRFNP |
| Ga0070706_1002909332 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGRYRRTTSEEELARIYHIPIPKQTDLPINYNIAPSQKVLTIRFNPEIQQRSLDALQ* |
| Ga0070706_1006743911 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MCERYRRTTKEEEGARQCNIRIPPQLDLPISYNTAPSQNVLVMA* |
| Ga0070697_1000129196 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RYRRTTQEEELARLYHIPIPKQTDLPISYNIAPRQKVLTIRFNPETQARSLDALHGD* |
| Ga0070697_1001591161 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPRQKV |
| Ga0066697_106539362 | 3300005540 | Soil | MCGRYRRTTSEEELARIYHIPIPKQTDLPISYNIAPSQKV |
| Ga0070763_103287601 | 3300005610 | Soil | MCGRYRRTTAEEEIARQFNIPIPPQLDLPISYNIAPTQNIL |
| Ga0070763_103498801 | 3300005610 | Soil | MCGRYRRTTAQEELARRYNIPIPPQRDLPISWNIAPAQDVLA |
| Ga0070763_105435893 | 3300005610 | Soil | MCGRYRRTTSEEELARRYHIPIPKELDLPISYNIAP |
| Ga0066903_1035642512 | 3300005764 | Tropical Forest Soil | MCGRYRRTSQEEELARLYRIPIPKQTDLPISFNIAPSQKVLAVRYDAKNSA |
| Ga0070766_100788135 | 3300005921 | Soil | MCGRYRRTSSEEELCKIYKIPFPRQLDLPVSYNIAPTLRILAIAVVTHFA |
| Ga0070765_1007096901 | 3300006176 | Soil | MRVRYRRATAEEEIARQYHIPIPPQLDLPISYNIAPTQD |
| Ga0126384_110429131 | 3300010046 | Tropical Forest Soil | MCGRYRRTTSEEELARLYHIPIPSQRDLPISWNVAPSQDVLVIRYNTKAEQRS |
| Ga0126382_116403482 | 3300010047 | Tropical Forest Soil | MCGRYRRTTAEEELARCYHIPIPPQRDLPIIWNIA |
| Ga0126372_126969241 | 3300010360 | Tropical Forest Soil | MCGRYRRTTSEEELAGLYHIPIPKQTDLPISYNIAPSQKILTI* |
| Ga0126378_103532563 | 3300010361 | Tropical Forest Soil | MCGRHRRTAQEEELARLYHIPIPKQTDLPISYNVAPSQKVLSIR |
| Ga0126381_1050299391 | 3300010376 | Tropical Forest Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNVAPSQKVLSI |
| Ga0137363_103094371 | 3300012202 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIVPSQKVLTIRFNPETQAR |
| Ga0137363_111507582 | 3300012202 | Vadose Zone Soil | MNSSYRTTKEEELARLYHIPIPKQTDLPISYNVAPSQKVLTIRFNPETQARSLDAL |
| Ga0137362_109522712 | 3300012205 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPRQTDLPISYNIAPS |
| Ga0137362_111498641 | 3300012205 | Vadose Zone Soil | MCGRYRRTTREDELARQYKIPIPPQLDLPISYNIAPSQNVFAIRFNPKRAQLSI* |
| Ga0137386_111662101 | 3300012351 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKV |
| Ga0137360_100272221 | 3300012361 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLT |
| Ga0137360_103934152 | 3300012361 | Vadose Zone Soil | MCGRYRRTTSEEELARLYHIPIPKQTDLPISYNIAPSQKVLTI |
| Ga0137360_107236263 | 3300012361 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNPE |
| Ga0137360_112624261 | 3300012361 | Vadose Zone Soil | MCGRYRRTTREEELARIYRIPIPSQPDLPISHNIAQVRKSSR |
| Ga0137361_108561312 | 3300012362 | Vadose Zone Soil | MCGRYRRTTSEEELARLYHIPIPKQTDLPISYNIAPSQK |
| Ga0137404_109445781 | 3300012929 | Vadose Zone Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNPETQHGRSMRCNGD |
| Ga0164301_104094001 | 3300012960 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNRIRLTNPIW |
| Ga0157375_122013482 | 3300013308 | Miscanthus Rhizosphere | MVVPTCADRRTTSEEELARRYHIAIPSERDLPISWNIAPTQDVLAIRFQPT |
| Ga0182036_103185941 | 3300016270 | Soil | MCGRYRRTTSEEELARLYHIPIPPQRDLPISWNIAPSQD |
| Ga0182041_103692701 | 3300016294 | Soil | MCGRYRRTTSEEELARLYHIPIPNQTDLPISYNIAPSQKVLTI |
| Ga0182033_107470412 | 3300016319 | Soil | MCGRYRRTTSEEELARLYHIPIPSQTDLPISYNIAPSQKVLAIRFNLKS |
| Ga0182032_106564961 | 3300016357 | Soil | MCGRYRRTTSEEELARLYHIPIPSQTDLPISYNIAPSQKVLTIRFKSEVVVVPFC |
| Ga0182032_119139631 | 3300016357 | Soil | MCGRYRRTTSEEELARLYHIPIPKQTDLPISYNNAPSQKVLTIRFHPQTRQRSRSARR |
| Ga0182034_105563272 | 3300016371 | Soil | TTQEEELTQPYHIPVPKQTDSPISYNVARSQKLSTIRI |
| Ga0182038_104951841 | 3300016445 | Soil | MCGRYRRTTSEEELARLYHIPIPPQRDLPISWNIAP |
| Ga0182038_106721413 | 3300016445 | Soil | MCGRYRRTTQEEELVRLYHIPIPKQTDLPISYNVAPSQKVLSIRFNPETRARSLDALQ |
| Ga0187863_100214771 | 3300018034 | Peatland | MCGRYRRTTAEDELARRYGVEIPRERDLPISWNIAPAQDILAIRYNPESKQ |
| Ga0210407_112611221 | 3300020579 | Soil | MCGRYRRTTREEELARRWSIPIPVQSDLPISWNVTPSTEVL |
| Ga0210399_113392981 | 3300020581 | Soil | MCGRYRRTTQEEELARIYHVPIPKQTDLPISYNADDTGR |
| Ga0210395_101418341 | 3300020582 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQK |
| Ga0210401_109884472 | 3300020583 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNLATQQRSL |
| Ga0210405_101013504 | 3300021171 | Soil | MCGRYRRTTQEEELARLYHIPIPISYNIAPSPSQKVLAIRYNRKSQERSLDALQ |
| Ga0210405_106442581 | 3300021171 | Soil | MCGRYRRTSREEEVARLYHIPIPKQTDLPISYNIAPSQKVL |
| Ga0210408_107089511 | 3300021178 | Soil | MCVRYRRTTPEEQLARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNPEI |
| Ga0210408_112368732 | 3300021178 | Soil | MCGRYRRTTHEEELARLYHIPIPKQTDLPISYNIAP |
| Ga0213872_100167187 | 3300021361 | Rhizosphere | MCGRNHRRTTAEEELARRYHIPIPPQRDLPIAWNIAL |
| Ga0213872_100948853 | 3300021361 | Rhizosphere | MCGRYRRTTSEEELARIYHIPIPKQTDLPISYNIAPSQKVLTIRFNPQI |
| Ga0213872_103475422 | 3300021361 | Rhizosphere | MCGRYRRTTSEEELARLYHIPILSQTDLPISYNIAPSQKVLAI |
| Ga0210397_104549901 | 3300021403 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAP |
| Ga0210397_109644951 | 3300021403 | Soil | MCGRYRRTTAEEELARRYHIPIPRQRDLPISWNIAPSEDVLAVRYNHETKQRS |
| Ga0210387_1000537218 | 3300021405 | Soil | RRTTSEEELASLYHIPIPSQTDLPISYNIAPSQKVLTIRFNPKSQQRSLDALQ |
| Ga0213878_104782562 | 3300021444 | Bulk Soil | MCGRYRRTTREEELARRYKIAIPRQTDLPISWNIAPGEKILA |
| Ga0210402_117621981 | 3300021478 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIVP |
| Ga0210409_109033532 | 3300021559 | Soil | MCGRYRRTTQEEELAQLYHIPIPKQTDLPISCNIAPSQKVLTIRFNADTQQR |
| Ga0126371_118284261 | 3300021560 | Tropical Forest Soil | MCGRYRRTTGEEELARLYHIPIPPQRDLPISWNIAPSQDV |
| Ga0209171_103396231 | 3300025320 | Iron-Sulfur Acid Spring | MCGRYRRTTQEEELARIYHVPIPKQTDLPISYNIAPSQKVLTIRFNRETQQRSL |
| Ga0207684_110282291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFNP |
| Ga0207663_111764792 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTKEEELARLYHIPIPKQTDLPISYNIDPSQKVLTIRFNPETQAR |
| Ga0207663_112563582 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTSSEEELCRIYNIAIPPQLDLPVSYNIAPSQKGTRNPIQS |
| Ga0207646_107045192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPKQTNLPISYNIAPS |
| Ga0207646_114078431 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPS |
| Ga0257157_10939722 | 3300026496 | Soil | MCGRYRRTTREEELARIYRIPIPSQPDLPISYNIAPSQEVL |
| Ga0179587_102956264 | 3300026557 | Vadose Zone Soil | MCGRYRRTTQEEELASLYHIPIPKQTDLPISYNIAPSQKVLTIRFNP |
| Ga0207949_10092782 | 3300026999 | Forest Soil | MCGRYRRTTQEEELARLYHTPIPKQTDLPISYNIAPSQKVLTIRFNLRLGH |
| Ga0209524_10489774 | 3300027521 | Forest Soil | MCGRYRRTTREEELARIYRIPIPSQPDLPISYNIAPS |
| Ga0209527_10753901 | 3300027583 | Forest Soil | MCGRYHRTTREEELARIYRIPIPSQSGLPISYNIAPSQEVLAIRFNP |
| Ga0209217_11924521 | 3300027651 | Forest Soil | MCGRYRRTTQEEELARIYHIPIPKQTDLPISYNIAPSQKVLTIRFNSESRARSLDV |
| Ga0209328_101568341 | 3300027727 | Forest Soil | MCGRYRRTSSEEELCKIYKIPIPPQLDLPVSYNIAPTLR |
| Ga0209656_103014392 | 3300027812 | Bog Forest Soil | RQNPHIRMCGRRTTQEEELARIYHIPIPKQTDLPISYNIAPSQNVLTIQFNSETQQRSLDALQGD |
| Ga0209380_107050302 | 3300027889 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIVPSQKVLTIRFNPEIQQRSLDALQCGLI |
| Ga0209624_104840241 | 3300027895 | Forest Soil | MCRRYGRTTAEEELPRWYHVPIPPQSDLSISWNIAPREGVVAIQV |
| Ga0222749_104367582 | 3300029636 | Soil | MCGRYRRTTQEEELARLYHIPIPRQTDLPISYNIAPSQRVLTIRFNP |
| Ga0310686_1066678675 | 3300031708 | Soil | MCGRYRRTTADEELAMRYGVPIPLERDLPISWNIAPTQDVLAIPVQS |
| Ga0306918_106441211 | 3300031744 | Soil | MEKIVMCGRYRRTTSEEELARLYHIPIPPQRDLPISWNVAPSQDVLV |
| Ga0307477_105330971 | 3300031753 | Hardwood Forest Soil | MCGRYRRTSSEEELCRIYNIAIPPQLDLPVSYNIAPSQK |
| Ga0318546_112928442 | 3300031771 | Soil | MCGRYRRTTQEEELARLYHIPIPKQTDLPISYNIAPSQKVLTIRFN |
| Ga0310917_101603721 | 3300031833 | Soil | MCRRYRRTTSQGRRARTRLYHILIPKQTDLPISYNIASIQKVLTIRFNPETRERSLDALQWGLI |
| Ga0306925_103955214 | 3300031890 | Soil | LARLYHIPIPKQTDLPISYNIAPSQKVLAIRFNPKSQQRSLDACERTIA |
| Ga0306925_117232611 | 3300031890 | Soil | HSLAMCGRYRRTTAEEEIAHQYHIPISPQLDLPISYNIAPTQNILGIATS |
| Ga0306921_102845393 | 3300031912 | Soil | MCGRYRRTTQEEELARLYHIPIPRQTDLPISYNIAPSQKVLTIRF |
| Ga0306921_118509182 | 3300031912 | Soil | MCARYTSEEELARLYHIPIPSQTDLPISYNIAPSQKVLTI |
| Ga0310916_104572481 | 3300031942 | Soil | MCGHYRRTTQEEELARLYHIPIPKQTDLPISYNVAPSQKVLSIRFNQE |
| Ga0310913_107984111 | 3300031945 | Soil | MCGRYRRTTSEEELARLYHIPNPKQADLPISHNIAPSQRVL |
| Ga0306926_120463791 | 3300031954 | Soil | MCGHYRRATQEEELARLYHIPIPKQTDLPISYNVAPSQKVLSIRFNPETRARSLDA |
| Ga0307479_106861112 | 3300031962 | Hardwood Forest Soil | MCGRYGLTTAEEELARGYHIPVPPQRDLPISWNIAPTEDVLAIRFNPELITLDV |
| Ga0307479_120167941 | 3300031962 | Hardwood Forest Soil | MCGRYRRTTSEEELARRYHIPIPKETDLPISYNIAPSQKVLTIRFNP |
| Ga0306922_108582542 | 3300032001 | Soil | MCGHYRRTTQEEELARLYHIPIPKQTDLPISYNVAPSQK |
| Ga0306924_112152371 | 3300032076 | Soil | MCGRYRRTTQEEELARLYHIPIPIQTDLPVSYNIAPSQNVLAIRF |
| Ga0311301_117196901 | 3300032160 | Peatlands Soil | MCGRYRRTTAEEELARRYHIPIPRQRDLPISWNIAP |
| Ga0307472_1004035303 | 3300032205 | Hardwood Forest Soil | MCGRYRRTTREEELARLYHIPIPKQTDLPISYNIAP |
| Ga0306920_1011129432 | 3300032261 | Soil | MCGRYRRTTQEEELARLYHIPIPIQTDLPVSYNIAP |
| Ga0306920_1011259201 | 3300032261 | Soil | MCGHYRRTTQEEELARLYHIPIPKQTDLPISYNVAPSQKVLSIRF |
| Ga0335076_101372414 | 3300032955 | Soil | MCGRYRRTTAEEEIARQYHIPMPPRLDLPISYNIAPSQNIL |
| Ga0310914_107708921 | 3300033289 | Soil | MCGRYRRTTSEEELARLYHIPIPPQRDLPISWNIAPS |
| ⦗Top⦘ |