


| Basic Information | |
|---|---|
| Family ID | F095728 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRAKA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.90 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 86.67 |
| PF04140 | ICMT | 3.81 |
| PF14833 | NAD_binding_11 | 2.86 |
| PF12697 | Abhydrolase_6 | 1.90 |
| PF03446 | NAD_binding_2 | 0.95 |
| PF12860 | PAS_7 | 0.95 |
| PF07536 | HWE_HK | 0.95 |
| PF12681 | Glyoxalase_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.95 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111022|2221209445 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 2228664021|ICCgaii200_c0432593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10101303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10126272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1013826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1036608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 516 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1036733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1062073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300005332|Ga0066388_102756276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300005447|Ga0066689_10488902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
| 3300005455|Ga0070663_102147957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300005536|Ga0070697_101271547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300005713|Ga0066905_100557141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300005764|Ga0066903_105717599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300005937|Ga0081455_10001118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 33528 | Open in IMG/M |
| 3300006034|Ga0066656_10976440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300006195|Ga0075366_10784077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300006800|Ga0066660_11708194 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006871|Ga0075434_101648182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300009012|Ga0066710_102899729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 673 | Open in IMG/M |
| 3300009100|Ga0075418_12150775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300009101|Ga0105247_10984542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300009156|Ga0111538_10254629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2222 | Open in IMG/M |
| 3300009792|Ga0126374_10206792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1247 | Open in IMG/M |
| 3300010043|Ga0126380_11567365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300010046|Ga0126384_11169289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300010358|Ga0126370_11364430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300010358|Ga0126370_12280784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300010360|Ga0126372_10701337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300010362|Ga0126377_10336422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1501 | Open in IMG/M |
| 3300010362|Ga0126377_11571109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300010366|Ga0126379_13209964 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010398|Ga0126383_11951351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300010398|Ga0126383_13250483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010868|Ga0124844_1006516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2474 | Open in IMG/M |
| 3300010868|Ga0124844_1082752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
| 3300010937|Ga0137776_1883879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300012198|Ga0137364_10472159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 942 | Open in IMG/M |
| 3300012203|Ga0137399_10811000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300012205|Ga0137362_10015620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5719 | Open in IMG/M |
| 3300012206|Ga0137380_10067582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3268 | Open in IMG/M |
| 3300012207|Ga0137381_11110854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300012362|Ga0137361_11520880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300012957|Ga0164303_11471289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300012989|Ga0164305_10441150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300013308|Ga0157375_11857639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300014307|Ga0075304_1032326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
| 3300015200|Ga0173480_10905698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300016270|Ga0182036_10506590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 957 | Open in IMG/M |
| 3300016294|Ga0182041_10638991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 938 | Open in IMG/M |
| 3300016294|Ga0182041_11730149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300016341|Ga0182035_10698022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300016341|Ga0182035_10996210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 742 | Open in IMG/M |
| 3300016341|Ga0182035_11863210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 545 | Open in IMG/M |
| 3300016357|Ga0182032_11070997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300018056|Ga0184623_10508020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300018071|Ga0184618_10412559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300018073|Ga0184624_10489665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300018081|Ga0184625_10241273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 947 | Open in IMG/M |
| 3300018081|Ga0184625_10633217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 520 | Open in IMG/M |
| 3300018468|Ga0066662_10510126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300018468|Ga0066662_11035639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300020580|Ga0210403_10010694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7461 | Open in IMG/M |
| 3300021088|Ga0210404_10811120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300021178|Ga0210408_11163668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300021560|Ga0126371_10207671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2057 | Open in IMG/M |
| 3300021560|Ga0126371_13821624 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300024330|Ga0137417_1470067 | All Organisms → cellular organisms → Bacteria | 5839 | Open in IMG/M |
| 3300025899|Ga0207642_10841923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300025910|Ga0207684_10699992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 861 | Open in IMG/M |
| 3300025939|Ga0207665_10127780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1801 | Open in IMG/M |
| 3300026041|Ga0207639_10687871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300026490|Ga0257153_1035891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
| 3300026540|Ga0209376_1058226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2171 | Open in IMG/M |
| 3300027909|Ga0209382_11357329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300028708|Ga0307295_10030418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1353 | Open in IMG/M |
| 3300028713|Ga0307303_10162185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 541 | Open in IMG/M |
| 3300028787|Ga0307323_10094348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1072 | Open in IMG/M |
| 3300031232|Ga0302323_101424816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031572|Ga0318515_10004513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5713 | Open in IMG/M |
| 3300031572|Ga0318515_10277654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300031679|Ga0318561_10123628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1376 | Open in IMG/M |
| 3300031681|Ga0318572_10084580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1767 | Open in IMG/M |
| 3300031708|Ga0310686_118058720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031716|Ga0310813_10217319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1576 | Open in IMG/M |
| 3300031719|Ga0306917_10244688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1372 | Open in IMG/M |
| 3300031719|Ga0306917_10310083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1220 | Open in IMG/M |
| 3300031748|Ga0318492_10173291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300031768|Ga0318509_10198680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1115 | Open in IMG/M |
| 3300031780|Ga0318508_1178564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 606 | Open in IMG/M |
| 3300031782|Ga0318552_10063585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1772 | Open in IMG/M |
| 3300031796|Ga0318576_10018418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2732 | Open in IMG/M |
| 3300031798|Ga0318523_10021302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2827 | Open in IMG/M |
| 3300031831|Ga0318564_10390416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300031835|Ga0318517_10006180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4041 | Open in IMG/M |
| 3300031890|Ga0306925_10191802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2202 | Open in IMG/M |
| 3300031896|Ga0318551_10087864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1637 | Open in IMG/M |
| 3300031912|Ga0306921_10681842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1182 | Open in IMG/M |
| 3300031945|Ga0310913_11179248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300032035|Ga0310911_10581703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 649 | Open in IMG/M |
| 3300032054|Ga0318570_10125811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1135 | Open in IMG/M |
| 3300032060|Ga0318505_10156614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1057 | Open in IMG/M |
| 3300032063|Ga0318504_10243106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300032180|Ga0307471_100876291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1065 | Open in IMG/M |
| 3300032805|Ga0335078_10291641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2199 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222046474 | 2209111022 | Grass Soil | MLDRAVELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| ICCgaii200_04325932 | 2228664021 | Soil | LDRAIELYDKFMDMGLGEKDVAAMVDVIAALPRSKPAR |
| AF_2010_repII_A1DRAFT_101013031 | 3300000597 | Forest Soil | SVGVGTPMLDRAVELYDKFMEMGFGEKDVAAMVDVIGALPPAKDKR* |
| AF_2010_repII_A1DRAFT_101262721 | 3300000597 | Forest Soil | LDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKT* |
| AP72_2010_repI_A1DRAFT_10138261 | 3300000650 | Forest Soil | VTTPMLDRAVELYDKFMDMGFGEXDVAAMVDVISALPRSKA* |
| AF_2010_repII_A10DRAFT_10366082 | 3300000816 | Forest Soil | ADSMGVATPMLDSAVELYDKFMDMGFGEKDVAAMVDVIGALPRSKP* |
| AP72_2010_repI_A100DRAFT_10367332 | 3300000837 | Forest Soil | RAVELYDKFMDMGLGEKDVAAMVDVIAALPRAKPAR* |
| AP72_2010_repI_A100DRAFT_10620732 | 3300000837 | Forest Soil | RAVELYDKFMAMGLGEKDVAAMVDVIGALPRANA* |
| Ga0066388_1027562761 | 3300005332 | Tropical Forest Soil | SVGVTTPMLDRAVELYDKFMDMGFGEKDVAAMVDVISALPRSKA* |
| Ga0066689_104889022 | 3300005447 | Soil | DSVGVATPMLDRAVELYAKFMAMGFGEKDVAAMVDVIGALPRAKS* |
| Ga0070663_1021479571 | 3300005455 | Corn Rhizosphere | TPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA* |
| Ga0070697_1012715472 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVATPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA* |
| Ga0066905_1005571411 | 3300005713 | Tropical Forest Soil | ADSVGVTTPMLDRAVELYDKFMDMGFGEKDVAAMVDVISALPRSKA* |
| Ga0066903_1057175992 | 3300005764 | Tropical Forest Soil | TPMLDRAAELYRRFIAMGLSEHDIAATMDVIASLPRPKKS* |
| Ga0081455_1000111826 | 3300005937 | Tabebuia Heterophylla Rhizosphere | METVGLVLYDKFMEMGFGEKDVAAMVDVIAALPPAKGKR* |
| Ga0066656_109764401 | 3300006034 | Soil | PMLDRAVELYDKFMEMGFGEKDVAAMVDVIGALPPAKGRR* |
| Ga0075366_107840771 | 3300006195 | Populus Endosphere | PMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA* |
| Ga0066660_117081941 | 3300006800 | Soil | TPMLDRAVELYDKLMQMGLGEHDVAVMVDVVAALPRSKSAAASQAKP* |
| Ga0075434_1016481822 | 3300006871 | Populus Rhizosphere | LDRAVELYDKFMAMGLGEKDVAAMVDVIGALPHAKA* |
| Ga0066710_1028997292 | 3300009012 | Grasslands Soil | SVGVATPMLDRAIELYEKFMEMGLGEKDGAAMVDVIAALPRAKT |
| Ga0075418_121507751 | 3300009100 | Populus Rhizosphere | AAELYQRFIDMGFAELDGAAMVDVIGSLPRTKNT* |
| Ga0105247_109845421 | 3300009101 | Switchgrass Rhizosphere | GVATPMLDRAVELYEKFMDMGFGEKDGAAMVDVIGALPRRKT* |
| Ga0111538_102546291 | 3300009156 | Populus Rhizosphere | RAVELYDKFIQMGLGEQDVAAMVDVIGALPRSKARD* |
| Ga0126374_102067923 | 3300009792 | Tropical Forest Soil | EFADSMGVATPVLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRSKA* |
| Ga0126380_115673651 | 3300010043 | Tropical Forest Soil | VTTPMLDRAVELYDKFMDMGFGEKDVAAMVDVISALPRSKA* |
| Ga0126384_111692891 | 3300010046 | Tropical Forest Soil | MLDRAVELYAKFIEMGLAEQDVAAMVDVISALPRKKS* |
| Ga0126370_113644301 | 3300010358 | Tropical Forest Soil | AFADSVGVATPMLDRAVELYDKFMDMGFAEKDVAAMVDVISALPHSKA* |
| Ga0126370_122807841 | 3300010358 | Tropical Forest Soil | DSVGVTTPMLDRAIELYDKFMDMGFGEKDVAAMVDVISALPRSKA* |
| Ga0126372_107013372 | 3300010360 | Tropical Forest Soil | VGVATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRSKA* |
| Ga0126377_103364223 | 3300010362 | Tropical Forest Soil | PLLDRAVELYDKFMDMGLGEKDVAAMVDVIAALPRSKPAR* |
| Ga0126377_115711091 | 3300010362 | Tropical Forest Soil | MLDRAVELYDKFMDMGFGEKDAAAMVDVIGALARSKA* |
| Ga0126379_132099642 | 3300010366 | Tropical Forest Soil | EFADSMGVATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRPKA* |
| Ga0126383_119513512 | 3300010398 | Tropical Forest Soil | SMGVATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRSKA* |
| Ga0126383_132504832 | 3300010398 | Tropical Forest Soil | SMGVATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRPKA* |
| Ga0124844_10065161 | 3300010868 | Tropical Forest Soil | ADGLGVATPMLDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKT* |
| Ga0124844_10827523 | 3300010868 | Tropical Forest Soil | DGLGVATPMLDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKT* |
| Ga0137776_18838793 | 3300010937 | Sediment | ALLDCAAALYERFMAMGFGEYDCAAMVDVVAALPRSKR* |
| Ga0137364_104721591 | 3300012198 | Vadose Zone Soil | ELYDKFMEMGLGEKDGAAMVDVIGALPRAKSPQSKS* |
| Ga0137399_108110001 | 3300012203 | Vadose Zone Soil | RATELYEKFIEMGLAEQDGAAMVDVIGALPRKKN* |
| Ga0137362_100156208 | 3300012205 | Vadose Zone Soil | VGVATPMLDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKARD* |
| Ga0137380_100675821 | 3300012206 | Vadose Zone Soil | TPMLDRAVELYDKFMEMDFGEKDVAAMVDVVSALPRAKA* |
| Ga0137381_111108541 | 3300012207 | Vadose Zone Soil | PMLDRAVELYDKFMAMGLGEKDVAAMVDVIGALPRAKA* |
| Ga0137361_115208802 | 3300012362 | Vadose Zone Soil | LDRAVELYDKFMDMGFGEKDVAAMVDVISALPRSKA* |
| Ga0164303_114712891 | 3300012957 | Soil | RAIELYAKFMDMGLGEKDVAAMVDVIAALPRSKPAR* |
| Ga0164305_104411502 | 3300012989 | Soil | PMLDRAVELYEKFMDMGFGEKDGAAMVDVIGALPRRKT* |
| Ga0157375_118576391 | 3300013308 | Miscanthus Rhizosphere | MLDRAAELYEKFMDMGLGENDGAAMVDVIGALPRRKA* |
| Ga0075304_10323261 | 3300014307 | Natural And Restored Wetlands | LLDRATELYAKFIEMGFAELDGAAMVDVIAALPRAKKS* |
| Ga0173480_109056982 | 3300015200 | Soil | ATPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA* |
| Ga0182036_105065901 | 3300016270 | Soil | RMLDRADDLYEKFVQMGVAEEDVAAMVDVIDALPRAKG |
| Ga0182041_106389911 | 3300016294 | Soil | SMGIATPMLDRAVELYDKLMQIGLGENDVAAMVDVVGALPRTKP |
| Ga0182041_117301492 | 3300016294 | Soil | LDTAVELYDKFMDMGLGEKDVAAMVDVIGALPRSKS |
| Ga0182035_106980222 | 3300016341 | Soil | DRAIELYDKFMDMGFGEKDVAAMVDVISALPRAKA |
| Ga0182035_109962102 | 3300016341 | Soil | MIGDFADSVGVGTPMLDRAVELFDKFMEMGFGEKDVAAMVDVIGAL |
| Ga0182035_118632102 | 3300016341 | Soil | VATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRAKA |
| Ga0182032_110709972 | 3300016357 | Soil | LDRAVELYDKFMDMGLGEKDVAAMVDVIGALPRSKA |
| Ga0184623_105080202 | 3300018056 | Groundwater Sediment | AASVGVATPMLDRAIELYERAMTMGIAEQDIAAMVDVIAAVPRAKP |
| Ga0184618_104125594 | 3300018071 | Groundwater Sediment | ISDFADSIGVATPMLDRATELYDKFMEMDFGEKDVAAMVDVIGALPRKKS |
| Ga0184624_104896651 | 3300018073 | Groundwater Sediment | TPMLDRAVELYEKFMDMGLGEKDGAAMVDVIGALPRRKT |
| Ga0184625_102412731 | 3300018081 | Groundwater Sediment | ATPMLDRAVELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0184625_106332171 | 3300018081 | Groundwater Sediment | VGVATPMLDRAVELYDKAIEMGLAEQDVAVMVDVIGALPPRKA |
| Ga0066662_105101262 | 3300018468 | Grasslands Soil | ATPLLDRAVELYDKFMDMGFGEKDAAAMVDVIAALPSSKPAR |
| Ga0066662_110356392 | 3300018468 | Grasslands Soil | ATPMLDRAIELYEKFMEMGLGEKDGAAMVDVIAALPRAKT |
| Ga0210403_100106941 | 3300020580 | Soil | VGVATPMLDRAAGLYDKFMDMGFAELDVAAMVDTVAALPRSKS |
| Ga0210404_108111201 | 3300021088 | Soil | PMLDRAVELYDKFMHMGFGEKDAAAMVDVIGALARPKA |
| Ga0210408_111636681 | 3300021178 | Soil | ATPMLDRAAGLYDKFMDMGFAELDVAAMVDTVAALPRSKS |
| Ga0126371_102076712 | 3300021560 | Tropical Forest Soil | MLDRAVELYDKFMEMGFGEKDVAAMVDVIGALPPAKDKR |
| Ga0126371_138216241 | 3300021560 | Tropical Forest Soil | DTAIELYDKFMDMGFGEKDVAAMVDVIGALPRSKS |
| Ga0137417_147006711 | 3300024330 | Vadose Zone Soil | MRGVATPMLDRAVGSTTSSWRLGFGEKDVAAMVDVIGALPRAKARD |
| Ga0207642_108419231 | 3300025899 | Miscanthus Rhizosphere | GVATPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0207684_106999921 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ADSVGVATPMLDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKARD |
| Ga0207665_101277801 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ATPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0207639_106878711 | 3300026041 | Corn Rhizosphere | VATPMLDRAAELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0257153_10358911 | 3300026490 | Soil | LDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRAKARD |
| Ga0209376_10582263 | 3300026540 | Soil | TPMLDRAVELYDKFMAMGLGEKDVAAMVDVIGALPRAKA |
| Ga0209382_113573291 | 3300027909 | Populus Rhizosphere | TPLLDRAAELYQRFIDMGFAELDGAAMVDVIGSLPRTKNT |
| Ga0307295_100304183 | 3300028708 | Soil | PMLDRAVELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0307303_101621852 | 3300028713 | Soil | DSVGVATPMLDRAVELYEKFMDMGLGEKDGAAMVDVIGALPRRKA |
| Ga0307323_100943481 | 3300028787 | Soil | PLLDRAIELYDKFMDMGLGEKDVAAMVDVIAALPRSKPAR |
| Ga0302323_1014248161 | 3300031232 | Fen | LLDRATELYAKFIEMGFAEKDGAAMVDVITALPRAKKN |
| Ga0318515_100045136 | 3300031572 | Soil | GEFAASVGVATPMLDRAVELYDKFMAMGFGEKDVAAMVDVIDALPRSKA |
| Ga0318515_102776542 | 3300031572 | Soil | VEVATPMLDRAVELYDKFMGMGFGEKDVAAMVDVIGALPRSKA |
| Ga0318561_101236281 | 3300031679 | Soil | MLDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRSKA |
| Ga0318572_100845801 | 3300031681 | Soil | SVGVTTPMLDRAIELYDKFMDMGFGEKDVAAMVDVISALPRAKA |
| Ga0310686_1180587202 | 3300031708 | Soil | AGVATPMLDCAAGLYQRFVDMGYGDFDVAKMVDVIGALPRRK |
| Ga0310813_102173191 | 3300031716 | Soil | SVGVATPMLDRAVELYEKFMDMGFGEKDGAAMVDVIGALPRRKT |
| Ga0306917_102446883 | 3300031719 | Soil | LDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRSKA |
| Ga0306917_103100833 | 3300031719 | Soil | DSMGVATPMLDRAVELYDKFMDMGFGEKDVAAMIDVIGALPRAKA |
| Ga0318492_101732912 | 3300031748 | Soil | VDVATPMLDRAVELYDKFMGMGFGEKDVAAMVDVIGALPRSKA |
| Ga0318509_101986802 | 3300031768 | Soil | SVGVGTPMLDRAVELYDKFMEMGFGEKDVAAMVDVIGALPPAKGKR |
| Ga0318508_11785641 | 3300031780 | Soil | GVATPMLDRAVELYDKFMDMGLGEKDVAAMVDVIGALPRSKA |
| Ga0318552_100635853 | 3300031782 | Soil | ADSVGVTTPMLDRAIELYDKFMDMGFGEKDVAAMVDVISALPRAKA |
| Ga0318576_100184181 | 3300031796 | Soil | THGHELVVELDRAVELYDKFMAMGFGEKDVAAMVDVIGALPRSKA |
| Ga0318523_100213021 | 3300031798 | Soil | DRAVELYDKFMAMGFGEKDVAAMVDVIGALPRSKA |
| Ga0318564_103904161 | 3300031831 | Soil | RMPNWVELYDKFMDMGLGEKDVAAMVDVIGALPRSKS |
| Ga0318517_100061805 | 3300031835 | Soil | ADSVGVATPMLDRAVELYDKFMDMGFGEKDVAATVDVISALPRAKA |
| Ga0306925_101918023 | 3300031890 | Soil | DGVGVATPMLDRAVELYDKFMDMGFGEKDAAAMVDVIGALARSKA |
| Ga0318551_100878641 | 3300031896 | Soil | GVATPVLDTAVELYDKFMDMGLGEKDVAAMVDVIGALPRSKS |
| Ga0306921_106818423 | 3300031912 | Soil | GAFADSVGVATPMLDRAIELYDKFMDMGFGEKDVAAMVDVISALPRAKA |
| Ga0310913_111792482 | 3300031945 | Soil | DRAVELYDKFMDMGLGEKDAAAMVDVIGALARSKA |
| Ga0310911_105817031 | 3300032035 | Soil | EFADGVGVATPMLDRAVELYDKFMDMGFGEKDAAAMVDVIGALARSKA |
| Ga0318570_101258112 | 3300032054 | Soil | FADSVGVNTPMLDRAIELYDKFMDMGFGEKDVAAMVDVISALPRAKA |
| Ga0318505_101566141 | 3300032060 | Soil | SMGVATPMLDRAVELYDKFMDMGFGEKDVAAMVDVIGALPRAKA |
| Ga0318504_102431061 | 3300032063 | Soil | LDRAVELYDKFMDMGLGEKDAAAMVDVIGALARSKA |
| Ga0307471_1008762912 | 3300032180 | Hardwood Forest Soil | DSVGVATPMLDRAVELYDKFMAMGLGEQDVAAMVDTIAALPRRKS |
| Ga0335078_102916414 | 3300032805 | Soil | DCAVGLYDRFMAMGFGGDDVARMVDVIGALPRAKT |
| ⦗Top⦘ |