


| Basic Information | |
|---|---|
| Family ID | F095725 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MRAEHILIPLALLNLLALSLGILFNILASFLPIAY |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.33 % |
| % of genes near scaffold ends (potentially truncated) | 5.71 % |
| % of genes from short scaffolds (< 2000 bps) | 77.14 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.095 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF09678 | Caa3_CtaG | 44.76 |
| PF13442 | Cytochrome_CBB3 | 22.86 |
| PF09828 | Chrome_Resist | 2.86 |
| PF13424 | TPR_12 | 1.90 |
| PF08402 | TOBE_2 | 0.95 |
| PF00115 | COX1 | 0.95 |
| PF00528 | BPD_transp_1 | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.14 % |
| Unclassified | root | N/A | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0790596 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0791651 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2076985 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 817 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101175769 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101213793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
| 3300000955|JGI1027J12803_104790391 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300000956|JGI10216J12902_100960632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2094 | Open in IMG/M |
| 3300002912|JGI25386J43895_10160035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300005332|Ga0066388_108372770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300005540|Ga0066697_10024685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3289 | Open in IMG/M |
| 3300005540|Ga0066697_10292073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300005552|Ga0066701_10238299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300005552|Ga0066701_10325111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 954 | Open in IMG/M |
| 3300005555|Ga0066692_10261744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300005555|Ga0066692_10920833 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005558|Ga0066698_10068652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2281 | Open in IMG/M |
| 3300005575|Ga0066702_10329750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 929 | Open in IMG/M |
| 3300005576|Ga0066708_10137660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300005713|Ga0066905_100071832 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300005713|Ga0066905_100108875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1902 | Open in IMG/M |
| 3300005713|Ga0066905_100172311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 1586 | Open in IMG/M |
| 3300005713|Ga0066905_100607551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300005713|Ga0066905_100638724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 906 | Open in IMG/M |
| 3300005764|Ga0066903_100025116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 6529 | Open in IMG/M |
| 3300005764|Ga0066903_100069834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4483 | Open in IMG/M |
| 3300005764|Ga0066903_101494728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
| 3300005764|Ga0066903_102345544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300005844|Ga0068862_100241058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1644 | Open in IMG/M |
| 3300006034|Ga0066656_10272272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300006196|Ga0075422_10019487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 2295 | Open in IMG/M |
| 3300006794|Ga0066658_10128275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300006796|Ga0066665_10106106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 2069 | Open in IMG/M |
| 3300006852|Ga0075433_10417824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300006852|Ga0075433_10782569 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300007076|Ga0075435_100022834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4830 | Open in IMG/M |
| 3300007255|Ga0099791_10053734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1807 | Open in IMG/M |
| 3300007255|Ga0099791_10504194 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300007258|Ga0099793_10174464 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300009038|Ga0099829_10337118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1240 | Open in IMG/M |
| 3300009137|Ga0066709_101231295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1101 | Open in IMG/M |
| 3300009157|Ga0105092_10278568 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300009162|Ga0075423_10018321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6898 | Open in IMG/M |
| 3300009610|Ga0105340_1032033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2043 | Open in IMG/M |
| 3300009803|Ga0105065_1038656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300010043|Ga0126380_10398916 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300010043|Ga0126380_10511378 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300010046|Ga0126384_10128893 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1917 | Open in IMG/M |
| 3300010046|Ga0126384_11372119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300010047|Ga0126382_10571315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 924 | Open in IMG/M |
| 3300010047|Ga0126382_11775991 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010304|Ga0134088_10687763 | Not Available | 513 | Open in IMG/M |
| 3300010336|Ga0134071_10030082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2363 | Open in IMG/M |
| 3300010336|Ga0134071_10093866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1419 | Open in IMG/M |
| 3300010358|Ga0126370_11436046 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010359|Ga0126376_10256992 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300010359|Ga0126376_11937487 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010360|Ga0126372_10765719 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300010361|Ga0126378_10186949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2141 | Open in IMG/M |
| 3300010362|Ga0126377_10086093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2833 | Open in IMG/M |
| 3300010362|Ga0126377_10496621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1251 | Open in IMG/M |
| 3300010362|Ga0126377_10856298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300010376|Ga0126381_104439510 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300011270|Ga0137391_10287322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1420 | Open in IMG/M |
| 3300012096|Ga0137389_10434763 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300012199|Ga0137383_11135656 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012204|Ga0137374_10179801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1848 | Open in IMG/M |
| 3300012349|Ga0137387_10009885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5557 | Open in IMG/M |
| 3300012355|Ga0137369_10094884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2463 | Open in IMG/M |
| 3300012582|Ga0137358_10067304 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300012582|Ga0137358_10492413 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300012685|Ga0137397_10845212 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012896|Ga0157303_10270833 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012922|Ga0137394_10415633 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1146 | Open in IMG/M |
| 3300012925|Ga0137419_11653511 | Not Available | 545 | Open in IMG/M |
| 3300012929|Ga0137404_10015794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5344 | Open in IMG/M |
| 3300012930|Ga0137407_10510537 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1123 | Open in IMG/M |
| 3300013297|Ga0157378_11030653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300015241|Ga0137418_10419061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1088 | Open in IMG/M |
| 3300015245|Ga0137409_10154983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2093 | Open in IMG/M |
| 3300015371|Ga0132258_13190876 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300018431|Ga0066655_10245723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1139 | Open in IMG/M |
| 3300018431|Ga0066655_11003219 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018433|Ga0066667_10012370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4184 | Open in IMG/M |
| 3300018468|Ga0066662_10336698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1290 | Open in IMG/M |
| 3300019789|Ga0137408_1036557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4110 | Open in IMG/M |
| 3300025910|Ga0207684_10012263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7462 | Open in IMG/M |
| 3300025922|Ga0207646_10139347 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2184 | Open in IMG/M |
| 3300027527|Ga0209684_1007424 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300027646|Ga0209466_1028798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1142 | Open in IMG/M |
| 3300027681|Ga0208991_1246467 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300027748|Ga0209689_1069001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1908 | Open in IMG/M |
| 3300027873|Ga0209814_10063100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1553 | Open in IMG/M |
| 3300027874|Ga0209465_10168689 | Not Available | 1089 | Open in IMG/M |
| 3300027874|Ga0209465_10338108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300027874|Ga0209465_10445463 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027880|Ga0209481_10403156 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031544|Ga0318534_10000513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13146 | Open in IMG/M |
| 3300031544|Ga0318534_10152353 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300031720|Ga0307469_10611715 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 975 | Open in IMG/M |
| 3300031720|Ga0307469_10813161 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031720|Ga0307469_11262059 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031720|Ga0307469_11803850 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031782|Ga0318552_10613634 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031820|Ga0307473_10209529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1164 | Open in IMG/M |
| 3300032180|Ga0307471_101128090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 949 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_07905963 | 3300000033 | Soil | MRAEHILIPLALLNLLALTLGIFFNVLANFIPIAY* |
| ICChiseqgaiiDRAFT_07916514 | 3300000033 | Soil | MRAEHILIPLALLNLVALILGILFNAFASFLGIT* |
| ICChiseqgaiiDRAFT_20769853 | 3300000033 | Soil | MRAERILIPLALLNLFTLVLGVLFNLLADLLGIT* |
| INPhiseqgaiiFebDRAFT_1011757693 | 3300000364 | Soil | MRAERILITLALLNLLALSLGILFNILANFLPIAY* |
| INPhiseqgaiiFebDRAFT_1012137932 | 3300000364 | Soil | MRAEHVLIPLALVNLFTLTLGLLFNAFASFLGIT* |
| JGI1027J12803_1047903913 | 3300000955 | Soil | MRAEHVLIPLALLNLFTLTLGLLFNAFASFLGIT* |
| JGI10216J12902_1009606322 | 3300000956 | Soil | MRAEHILIPLALLNLVALILGILFNTFASFLGIT* |
| JGI25386J43895_101600353 | 3300002912 | Grasslands Soil | MRAERILIPLALLNLVVLILGVVFNIVADLVGITSVSTIERV |
| Ga0066388_1083727702 | 3300005332 | Tropical Forest Soil | PVGAEMRAEKILIVLVLLNLLALSLGVLFNILAHFLPLAY* |
| Ga0066697_100246856 | 3300005540 | Soil | MRAEHILIPLALLNLLALILGILFNVLASFLPIAY* |
| Ga0066697_102920734 | 3300005540 | Soil | VRAERILITLALLNLLALSLGILFNILANYLPIAY* |
| Ga0066701_102382992 | 3300005552 | Soil | MRAERILIPLALLNLAALILGVVYNLVADLLGLP* |
| Ga0066701_103251114 | 3300005552 | Soil | MRAERFLIPLALLNLAALILGILYNILASLLALP* |
| Ga0066692_102617443 | 3300005555 | Soil | MRAEHILIPLALLNFLALVLGILFNVLASFLPIAY* |
| Ga0066692_109208333 | 3300005555 | Soil | MRVERILIPLAFLNLVVLILGVVFNIVADLLGIT* |
| Ga0066698_100686522 | 3300005558 | Soil | MRAERILIPLALLNLVALILGVVYNLVADFLGLP* |
| Ga0066702_103297501 | 3300005575 | Soil | MRAEYILIPLALLNLLALSLGILFNVLASFLPIAY* |
| Ga0066708_101376604 | 3300005576 | Soil | VRAERILITLALLNLLALSLGILFNILASFLPIAY* |
| Ga0066905_1000718323 | 3300005713 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGVLFNILAHFLPIAR* |
| Ga0066905_1001088754 | 3300005713 | Tropical Forest Soil | VRAERILIVLALLNLVTLSLGVLFNILANFLPIAY* |
| Ga0066905_1001723113 | 3300005713 | Tropical Forest Soil | MRAERILIPLALLNLLTLVLGVLFNLVADLLGIT* |
| Ga0066905_1006075513 | 3300005713 | Tropical Forest Soil | MRAERILIPLALLNLLALVLGVLFNLVADLLGIT* |
| Ga0066905_1006387241 | 3300005713 | Tropical Forest Soil | MRAEHILIPLALLNLLALTLGILFNVLANFLPIAY* |
| Ga0066903_1000251164 | 3300005764 | Tropical Forest Soil | MRAEKILIVLVLLNLLALSLGVLFNILAHFLPLAY* |
| Ga0066903_1000698342 | 3300005764 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGVLFNILAHFLPIAY* |
| Ga0066903_1014947283 | 3300005764 | Tropical Forest Soil | MRAERILIPLALLNILTLVLGVLFNLVADLLGIT* |
| Ga0066903_1023455442 | 3300005764 | Tropical Forest Soil | VRAERILIILALLNLLALSLGVMFNILANFLPIAY* |
| Ga0068862_1002410582 | 3300005844 | Switchgrass Rhizosphere | MRAEHILIPLALLNLFTLILGLLFNVFASYLGIT* |
| Ga0066656_102722723 | 3300006034 | Soil | MRAEHILIPLALLNLLALVLGILFNVLASFLPIAY* |
| Ga0075422_100194874 | 3300006196 | Populus Rhizosphere | MRAEHVLIPLALLNLLALTLGIFFNVLANFIPIAY* |
| Ga0066658_101282753 | 3300006794 | Soil | MRAEHILIPLALLNLLALILGILFNLLASFLPIAY* |
| Ga0066665_101061063 | 3300006796 | Soil | MRAEYILIPLALLNLLALVLGILFNVLASFLPIAY* |
| Ga0075433_104178244 | 3300006852 | Populus Rhizosphere | LRAEHILIPLALLNLLTLILGVLFNAFASFFGIT* |
| Ga0075433_107825693 | 3300006852 | Populus Rhizosphere | MRAEHILIPLALLNLLALTLGIFFNVLASFIPIAY* |
| Ga0075435_1000228344 | 3300007076 | Populus Rhizosphere | LRAEHILIPLALLNLLTLVLGVLFNAFASFFGIT* |
| Ga0099791_100537344 | 3300007255 | Vadose Zone Soil | MRAEHILIPLALLNLLALGLGILFNILANFLPIAY* |
| Ga0099791_105041943 | 3300007255 | Vadose Zone Soil | MRAEHILIPLALLNLLALILGILFNVLASFLPIPY* |
| Ga0099793_101744643 | 3300007258 | Vadose Zone Soil | MRAEHILIPLALLNLLALSLGILFNILASFLPIAY* |
| Ga0099829_103371181 | 3300009038 | Vadose Zone Soil | MRAERILIPLALLNLVALILGVVYNIVADLLGLT* |
| Ga0066709_1012312952 | 3300009137 | Grasslands Soil | MRAERILIPLALLNLVALIRGVVYNIVADFLGLP* |
| Ga0105092_102785683 | 3300009157 | Freshwater Sediment | MRAEHILIPLALLNLLALILGVLFNFFASALGIT* |
| Ga0075423_100183217 | 3300009162 | Populus Rhizosphere | MRAEHILIPLALLNLFALILGILFNAFAGLLGIS* |
| Ga0105340_10320335 | 3300009610 | Soil | MRAERILISLAWLNLVALILGVLFNLFADLMGIT* |
| Ga0105065_10386564 | 3300009803 | Groundwater Sand | MRAERILIPLALLNLVVLILGVVFNIVADLLGIT* |
| Ga0126380_103989164 | 3300010043 | Tropical Forest Soil | VRAERILIVLALLNLLALSLGVLFNILANFLPIAY* |
| Ga0126380_105113782 | 3300010043 | Tropical Forest Soil | MRAEKILIVLALVNLLALSLGVLFNILAHFLPIAY* |
| Ga0126384_101288934 | 3300010046 | Tropical Forest Soil | MRAERILIPLALLNLVALVLGVLFNLVADLLGIT* |
| Ga0126384_113721192 | 3300010046 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGALFNILAHFVPIAY* |
| Ga0126382_105713153 | 3300010047 | Tropical Forest Soil | MRAERILISLALLNLLALVLGVLFNLVADLLGIT* |
| Ga0126382_117759913 | 3300010047 | Tropical Forest Soil | VRAERILITLALLNLLALTLGIFFNVLANFLPIAY* |
| Ga0134088_106877633 | 3300010304 | Grasslands Soil | MRAERILIPLALLNLAALILGVVYNLVADFLGLP* |
| Ga0134071_100300823 | 3300010336 | Grasslands Soil | MRAERILIPLALLNLVALILGVVYNIVADFLGLP* |
| Ga0134071_100938663 | 3300010336 | Grasslands Soil | MRAERILIPLALLNLVALILGVVFNIVADLLGIT* |
| Ga0126370_114360462 | 3300010358 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGVLFNILARFLPIAY* |
| Ga0126376_102569924 | 3300010359 | Tropical Forest Soil | MRAKRILIPLALLNLFTLVLGVLFNLLADLLGIT* |
| Ga0126376_119374871 | 3300010359 | Tropical Forest Soil | PAVKVERILIPLALLNLAVLALEGLYQLVRTLLGH* |
| Ga0126372_107657191 | 3300010360 | Tropical Forest Soil | VRAERILIVLALLNLLALSLGVMFNILANFLPIAY* |
| Ga0126378_101869492 | 3300010361 | Tropical Forest Soil | MRAEKILIVLVLLNLLALSLGVLFNILAHFLPIAY* |
| Ga0126377_100860934 | 3300010362 | Tropical Forest Soil | VRAERILIVLALLNLVTLSLGILFNILANFLPIAY* |
| Ga0126377_104966211 | 3300010362 | Tropical Forest Soil | PRCRSVGAGVRAERILIVLALLNLVTLSLGVLFNILANFLPIAY* |
| Ga0126377_108562983 | 3300010362 | Tropical Forest Soil | MRAEHILIPLALLNLLALVLGVLFNLVADLLGIT* |
| Ga0126381_1044395102 | 3300010376 | Tropical Forest Soil | VRAERILIILALLNLLALSLGVLFNILAHFLPIAY* |
| Ga0137391_102873222 | 3300011270 | Vadose Zone Soil | MRAERILIPLALLNLVVLILGVVFNIVADLVGIT* |
| Ga0137389_104347633 | 3300012096 | Vadose Zone Soil | MRAEHILIPLALLNLLALILGILFNVLASFLPIS* |
| Ga0137383_111356561 | 3300012199 | Vadose Zone Soil | MRAEHILIPLALLNLLTLLLGVLFNAFASFLGIT* |
| Ga0137374_101798012 | 3300012204 | Vadose Zone Soil | MRAERILIPLALLNLVALIMGVVYNIVADFLGLP* |
| Ga0137387_100098856 | 3300012349 | Vadose Zone Soil | MRAERILIPLALLNLVALILGVVYNIFADFLGLP* |
| Ga0137369_100948843 | 3300012355 | Vadose Zone Soil | MRAERILIPLALLNLVALIMGVVYNLVANLLGLP* |
| Ga0137358_100673044 | 3300012582 | Vadose Zone Soil | MRAEHILIPLALLNLLALSLGILFNILANFLPIAY* |
| Ga0137358_104924133 | 3300012582 | Vadose Zone Soil | MRAEHILIPLALLNLLALILGIMFNVLASFLPIPY* |
| Ga0137397_108452122 | 3300012685 | Vadose Zone Soil | VRAEHILIPLALLNLLALVLGILFNVLASFLPIAY* |
| Ga0157303_102708333 | 3300012896 | Soil | MRAEHVLIPLALLNLFTLLLGLLFNVFASYLGIT* |
| Ga0137394_104156333 | 3300012922 | Vadose Zone Soil | VRAEHILIPLALLNLLALILGILFNVLASFLPIAY* |
| Ga0137419_116535113 | 3300012925 | Vadose Zone Soil | MRVERILIPLALLNLLALGLGVLFNLVADLLGIT* |
| Ga0137404_100157944 | 3300012929 | Vadose Zone Soil | MRAERILIPLALLNLLALVLGVIFNLVADLLGIT* |
| Ga0137407_105105373 | 3300012930 | Vadose Zone Soil | MRAERILIPLALLNLVALILGVVYNLVADLLGLP* |
| Ga0157378_110306532 | 3300013297 | Miscanthus Rhizosphere | MRAEQILIPLALLNLFTLILGLLFNVFASYLGIT* |
| Ga0137418_104190613 | 3300015241 | Vadose Zone Soil | MRVERILIPLALLNLLALVLGVLFNLVADLLGIT* |
| Ga0137409_101549831 | 3300015245 | Vadose Zone Soil | MRAERILIPLALLNLVVLVLGVVFNIVADLLGIT* |
| Ga0132258_131908762 | 3300015371 | Arabidopsis Rhizosphere | LRAEHILIPLALLNLLTLILGVLFNAFASFLGIT* |
| Ga0066655_102457233 | 3300018431 | Grasslands Soil | MRAEHILIPLALLNLLALILGILFNLLASFLPIAY |
| Ga0066655_110032192 | 3300018431 | Grasslands Soil | VRAERILITLALLNLLALSLGILFNILANYLPIAY |
| Ga0066667_100123706 | 3300018433 | Grasslands Soil | VRAERILITLALLNLLALSLGILFNILASFLPIAY |
| Ga0066662_103366983 | 3300018468 | Grasslands Soil | MRAEHILIPLALLNLLALILGILFNVLASFLPIAY |
| Ga0137408_10365572 | 3300019789 | Vadose Zone Soil | MRAEHILIPLALLNLLALILGILFNVLASFLPIPY |
| Ga0207684_100122636 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAEHILIPLALLNLLALVLGILFNVLASFLPIAY |
| Ga0207646_101393474 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAEHILIPLALLNLLALVLGILFNVLASFLPIAY |
| Ga0209684_10074242 | 3300027527 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGVLFNILAHFLPLAY |
| Ga0209466_10287984 | 3300027646 | Tropical Forest Soil | VRAERILIVLALLNLVTLSLGVLFNILANFLPIAY |
| Ga0208991_12464672 | 3300027681 | Forest Soil | MRAEHILIPLALLNLLALSLGILFNILASFLPIAY |
| Ga0209689_10690012 | 3300027748 | Soil | MRAEYILIPLALLNLLALVLGILFNVLASFLPIAY |
| Ga0209814_100631004 | 3300027873 | Populus Rhizosphere | MRAEHILIPLALLNLLALTLGIFFNVLANFIPIAY |
| Ga0209465_101686892 | 3300027874 | Tropical Forest Soil | AEMRAEKILIVLVLLNLLALSLGVLFNILAHFLPLAY |
| Ga0209465_103381082 | 3300027874 | Tropical Forest Soil | VRAERILIILALLNLLALSLGVMFNILANFLPIAY |
| Ga0209465_104454632 | 3300027874 | Tropical Forest Soil | MRAEKILIVLALLNLLALSLGVLFNILAHFLPIAY |
| Ga0209481_104031562 | 3300027880 | Populus Rhizosphere | MRAEHVLIPLALLNLLALTLGIFFNVLANFIPIAY |
| Ga0318534_1000051311 | 3300031544 | Soil | MRAEKILIVLVLLNLLALSLGVLFNILAHFLPLAY |
| Ga0318534_101523532 | 3300031544 | Soil | MWAEKILIVLALLNLLALSLGVLFNIVAHFLAIAY |
| Ga0307469_106117154 | 3300031720 | Hardwood Forest Soil | MRAERILITLALLNLLALGLGILFNILANFLPIAY |
| Ga0307469_108131613 | 3300031720 | Hardwood Forest Soil | VRAERILIPLALLNLLALVLGILFNVLASFLPIAY |
| Ga0307469_112620593 | 3300031720 | Hardwood Forest Soil | MRAEHILIPLALLNLLALSLGVLFNILANFLPIAY |
| Ga0307469_118038503 | 3300031720 | Hardwood Forest Soil | MRAEHILIPLALLNLLALGLGILFNILANFLPIAY |
| Ga0318552_106136341 | 3300031782 | Soil | MRAEKILIVLVLLNLLALSLGVLFNIVAHFLAIAY |
| Ga0307473_102095293 | 3300031820 | Hardwood Forest Soil | VRAERILIVLALLNLLALSLGILFNILASFLPIAY |
| Ga0307471_1011280903 | 3300032180 | Hardwood Forest Soil | MRAEHILIPLALLNLLALSLGILFNILANFLPIAY |
| ⦗Top⦘ |