


| Basic Information | |
|---|---|
| Family ID | F095698 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.76 % |
| % of genes near scaffold ends (potentially truncated) | 21.90 % |
| % of genes from short scaffolds (< 2000 bps) | 70.48 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.190 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (24.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.381 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (33.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 3.85% Coil/Unstructured: 57.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF06114 | Peptidase_M78 | 13.33 |
| PF02464 | CinA | 3.81 |
| PF04608 | PgpA | 2.86 |
| PF04434 | SWIM | 2.86 |
| PF09572 | RE_XamI | 1.90 |
| PF00701 | DHDPS | 1.90 |
| PF01726 | LexA_DNA_bind | 1.90 |
| PF01555 | N6_N4_Mtase | 0.95 |
| PF00149 | Metallophos | 0.95 |
| PF09549 | RE_Bpu10I | 0.95 |
| PF02384 | N6_Mtase | 0.95 |
| PF00793 | DAHP_synth_1 | 0.95 |
| PF00892 | EamA | 0.95 |
| PF01850 | PIN | 0.95 |
| PF00749 | tRNA-synt_1c | 0.95 |
| PF13563 | 2_5_RNA_ligase2 | 0.95 |
| PF05935 | Arylsulfotrans | 0.95 |
| PF01809 | YidD | 0.95 |
| PF12950 | TaqI_C | 0.95 |
| PF00815 | Histidinol_dh | 0.95 |
| PF11185 | DUF2971 | 0.95 |
| PF07669 | Eco57I | 0.95 |
| PF00717 | Peptidase_S24 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 3.81 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 3.81 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 2.86 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 2.86 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 2.86 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 2.86 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.95 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.05 % |
| Unclassified | root | N/A | 20.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001580|Draft_10081641 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300001580|Draft_10275314 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300002465|LO132_10067391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1380 | Open in IMG/M |
| 3300003859|Ga0031653_10144256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300004481|Ga0069718_10018478 | All Organisms → cellular organisms → Bacteria | 3057 | Open in IMG/M |
| 3300005254|Ga0068714_10013660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6538 | Open in IMG/M |
| 3300006224|Ga0079037_100314620 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300006224|Ga0079037_102296495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 539 | Open in IMG/M |
| 3300009053|Ga0105095_10006213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6476 | Open in IMG/M |
| 3300009078|Ga0105106_10192410 | Not Available | 1490 | Open in IMG/M |
| 3300009087|Ga0105107_10195379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → unclassified Methylococcus → Methylococcus sp. EFPC2 | 1418 | Open in IMG/M |
| 3300009111|Ga0115026_11399675 | Not Available | 578 | Open in IMG/M |
| 3300009153|Ga0105094_10101016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylococcus → unclassified Methylococcus → Methylococcus sp. EFPC2 | 1627 | Open in IMG/M |
| 3300009153|Ga0105094_10828802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 545 | Open in IMG/M |
| 3300009167|Ga0113563_10234604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1854 | Open in IMG/M |
| 3300009171|Ga0105101_10231873 | Not Available | 893 | Open in IMG/M |
| 3300010288|Ga0116210_1036469 | Not Available | 1128 | Open in IMG/M |
| 3300010324|Ga0129297_10432561 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010324|Ga0129297_10458158 | Not Available | 565 | Open in IMG/M |
| 3300012931|Ga0153915_10221546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2084 | Open in IMG/M |
| 3300012931|Ga0153915_10393201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1568 | Open in IMG/M |
| 3300012931|Ga0153915_12190077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300012931|Ga0153915_12594614 | Not Available | 592 | Open in IMG/M |
| 3300012931|Ga0153915_13297416 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. UDSM-2020 | 524 | Open in IMG/M |
| 3300012964|Ga0153916_10910431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300012964|Ga0153916_11697568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 705 | Open in IMG/M |
| 3300012964|Ga0153916_11850540 | Not Available | 675 | Open in IMG/M |
| 3300012964|Ga0153916_12242098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 614 | Open in IMG/M |
| 3300017939|Ga0187775_10072418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 1103 | Open in IMG/M |
| 3300017939|Ga0187775_10194676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 749 | Open in IMG/M |
| 3300017961|Ga0187778_10033802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3127 | Open in IMG/M |
| 3300017961|Ga0187778_11082700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
| 3300017966|Ga0187776_10131835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1520 | Open in IMG/M |
| 3300017966|Ga0187776_10478098 | Not Available | 848 | Open in IMG/M |
| 3300017973|Ga0187780_10002805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 13107 | Open in IMG/M |
| 3300017973|Ga0187780_10318328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1095 | Open in IMG/M |
| 3300017973|Ga0187780_10367514 | Not Available | 1018 | Open in IMG/M |
| 3300018004|Ga0187865_1128569 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300018029|Ga0187787_10085522 | Not Available | 991 | Open in IMG/M |
| 3300018029|Ga0187787_10196487 | Not Available | 710 | Open in IMG/M |
| 3300018032|Ga0187788_10005522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3844 | Open in IMG/M |
| 3300018032|Ga0187788_10085951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1119 | Open in IMG/M |
| 3300018058|Ga0187766_10124820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10 | 1580 | Open in IMG/M |
| 3300018062|Ga0187784_10018325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5656 | Open in IMG/M |
| 3300018062|Ga0187784_10084278 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300018062|Ga0187784_10431155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300018064|Ga0187773_10080502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1565 | Open in IMG/M |
| 3300018064|Ga0187773_10421054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300018086|Ga0187769_10098885 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 2094 | Open in IMG/M |
| 3300018088|Ga0187771_10021014 | All Organisms → cellular organisms → Bacteria | 4865 | Open in IMG/M |
| 3300018088|Ga0187771_10124485 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → Methanomassiliicoccaceae → Methanomassiliicoccus → Methanomassiliicoccus luminyensis | 2099 | Open in IMG/M |
| 3300018088|Ga0187771_10467313 | Not Available | 1066 | Open in IMG/M |
| 3300018088|Ga0187771_10907150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 747 | Open in IMG/M |
| 3300018089|Ga0187774_10724169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 662 | Open in IMG/M |
| 3300018090|Ga0187770_11282103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 594 | Open in IMG/M |
| 3300020083|Ga0194111_10306053 | Not Available | 1091 | Open in IMG/M |
| 3300020083|Ga0194111_10652872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 653 | Open in IMG/M |
| 3300020084|Ga0194110_10060688 | All Organisms → cellular organisms → Bacteria | 3337 | Open in IMG/M |
| 3300020084|Ga0194110_10235456 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300020222|Ga0194125_10802911 | Not Available | 537 | Open in IMG/M |
| 3300022208|Ga0224495_10427284 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300022551|Ga0212089_10520805 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| (restricted) 3300023177|Ga0233423_10182849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22 | 896 | Open in IMG/M |
| 3300025104|Ga0209721_1033487 | Not Available | 989 | Open in IMG/M |
| 3300027690|Ga0209164_1000741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 59268 | Open in IMG/M |
| 3300027723|Ga0209703_1233002 | Not Available | 668 | Open in IMG/M |
| 3300027731|Ga0209592_1030685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. NDM | 2027 | Open in IMG/M |
| 3300027731|Ga0209592_1046744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1624 | Open in IMG/M |
| 3300027811|Ga0256868_10397543 | Not Available | 555 | Open in IMG/M |
| 3300027877|Ga0209293_10368178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 740 | Open in IMG/M |
| 3300027900|Ga0209253_10008088 | All Organisms → cellular organisms → Bacteria | 9070 | Open in IMG/M |
| 3300030613|Ga0299915_10645101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 676 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1335398 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031707|Ga0315291_11159045 | Not Available | 636 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10117379 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10333653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 539 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10177395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Achromatium → environmental samples → uncultured Achromatium sp. | 973 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10269890 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1021267 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_60_9 | 3745 | Open in IMG/M |
| 3300032770|Ga0335085_10118003 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → Methanomassiliicoccaceae → Methanomassiliicoccus → Methanomassiliicoccus luminyensis | 3393 | Open in IMG/M |
| 3300032829|Ga0335070_10000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 108950 | Open in IMG/M |
| 3300032829|Ga0335070_10022482 | All Organisms → cellular organisms → Bacteria | 7265 | Open in IMG/M |
| 3300032829|Ga0335070_10054517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4377 | Open in IMG/M |
| 3300032829|Ga0335070_10129063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2602 | Open in IMG/M |
| 3300032892|Ga0335081_10145591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_48_10 | 3400 | Open in IMG/M |
| 3300032892|Ga0335081_10158843 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300033402|Ga0326728_10004305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 42392 | Open in IMG/M |
| 3300033413|Ga0316603_10641925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 988 | Open in IMG/M |
| 3300033433|Ga0326726_10012392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7489 | Open in IMG/M |
| 3300033433|Ga0326726_10064596 | All Organisms → cellular organisms → Bacteria | 3222 | Open in IMG/M |
| 3300033480|Ga0316620_10080170 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300033486|Ga0316624_11536942 | Not Available | 612 | Open in IMG/M |
| 3300033489|Ga0299912_10037753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4212 | Open in IMG/M |
| 3300033513|Ga0316628_100038059 | All Organisms → cellular organisms → Bacteria | 4826 | Open in IMG/M |
| 3300033513|Ga0316628_100451144 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300033513|Ga0316628_100721466 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1309 | Open in IMG/M |
| 3300033513|Ga0316628_102230081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300033513|Ga0316628_102982546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 619 | Open in IMG/M |
| 3300033513|Ga0316628_104391093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300033804|Ga0314863_022888 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300033807|Ga0314866_045866 | Not Available | 707 | Open in IMG/M |
| 3300033977|Ga0314861_0037388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2817 | Open in IMG/M |
| 3300033991|Ga0334965_0133933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1056 | Open in IMG/M |
| 3300033991|Ga0334965_0351775 | Not Available | 550 | Open in IMG/M |
| 3300034090|Ga0326723_0346272 | Not Available | 670 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 24.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 15.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.57% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 8.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.76% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.81% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.86% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.86% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.90% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.90% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.90% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.95% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010288 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Tshipise hot spring metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300023177 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MG | Environmental | Open in IMG/M |
| 3300025104 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Tshipise hot spring metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031806 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_100816412 | 3300001580 | Hydrocarbon Resource Environments | MRIFLESEEFWFEDFKVDNLTAAISQLKALHRDCKESFKEDGIVRKIGIIIE* |
| Draft_102753142 | 3300001580 | Hydrocarbon Resource Environments | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE* |
| LO132_100673911 | 3300002465 | Freshwater Lake | MRIFLESEEYWFEDFKVDNLTQAISELKALYRNCKESFKEDGIVRKIGVIIE* |
| Ga0031653_101442562 | 3300003859 | Freshwater Lake Sediment | ESEEYWFEDFKVDNLTQAISELKALYRNCKESFKEDGIVRKIGVIIE* |
| Ga0069718_100184783 | 3300004481 | Sediment | MRIFLESEEYWFEDFKVDNLTEAISELKALYRDCKECFKEDGIVRKIGVIIE* |
| Ga0068714_100136608 | 3300005254 | Enrichment Culture | MRIFLESEEFWFEDFKVDNLTAAISQLKALYRDCKDSFKEDGIVRKIGIIIE* |
| Ga0079037_1003146202 | 3300006224 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTEAISKLKVLYRDCKDCFKEDGIVRKIGVIIE* |
| Ga0079037_1022964952 | 3300006224 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVI |
| Ga0105095_100062135 | 3300009053 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIDRKIGVIIE* |
| Ga0105106_101924102 | 3300009078 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTDAISELKALYRDCKESFKEDGIVRKIGVIIE* |
| Ga0105107_101953792 | 3300009087 | Freshwater Sediment | VGEKMRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIDRKIGVIIE* |
| Ga0115026_113996751 | 3300009111 | Wetland | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCEECFKEDGIVRKIGLIIE* |
| Ga0105094_101010162 | 3300009153 | Freshwater Sediment | VGEKMRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE* |
| Ga0105094_108288021 | 3300009153 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKALYRHCKESFKEDGIVRKIGVIIE* |
| Ga0113563_102346044 | 3300009167 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTEAISKLKALYLDCKECFKEDGIVRKIGVIIE* |
| Ga0105101_102318732 | 3300009171 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTQAISELRALYRDCKESFKEDGIVRKIGVIIE* |
| Ga0116210_10364691 | 3300010288 | Hot Spring | MRIFLESEEFWFEDFKVDNLMEAISKLKALYRDCRECFKEDRIVRKIGIIIE* |
| Ga0129297_104325612 | 3300010324 | Lake Sediment | MRIFLESEEYWFEDFKVDNLTQAISQLKALYRDCKESFKEDGIVRNIGIIIE* |
| Ga0129297_104581582 | 3300010324 | Lake Sediment | MRIFLESEEYWFEDFKVDNLTQAIYELKALYRDCKESFKEDGIVRKIGIIIE* |
| Ga0153915_102215462 | 3300012931 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTQAISELRALYRDCKESFKEDAIVRKIGVIIE* |
| Ga0153915_103932013 | 3300012931 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKECFKEDGIVRKIGIVIE* |
| Ga0153915_121900771 | 3300012931 | Freshwater Wetlands | KMRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKECFKEDGIVRKIGVIIE* |
| Ga0153915_125946141 | 3300012931 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLRQAISELKTLYRDCKESFKEDGIVRKIGVIIE* |
| Ga0153915_132974161 | 3300012931 | Freshwater Wetlands | KMRIFLESEEYWFEDFKVDNLTEAISKLKALYRDCRECFKEDGIVRKIGVIIE* |
| Ga0153916_109104312 | 3300012964 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLAQAISELKALYRDCKESFKEDGIVRKIGVIIE* |
| Ga0153916_116975682 | 3300012964 | Freshwater Wetlands | MRIFLESEEYWFEDFKADNLTQAISELKALYRDCKECFKEDGIVRKIGVIIE* |
| Ga0153916_118505402 | 3300012964 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTEAISKLKALYRDCKECFKEDGIVRKIGVIIE* |
| Ga0153916_122420982 | 3300012964 | Freshwater Wetlands | MRIFLESEEYWFEDFKVDNLTQAISELRALYRDCKE |
| Ga0187775_100724182 | 3300017939 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTQAISELKTLFRNCKECFKEDGIVRKIGIIIE |
| Ga0187775_101946762 | 3300017939 | Tropical Peatland | MRIFLESDEFWFEDFKVDNLTEAISELKTLYRNCKECFK |
| Ga0187778_100338022 | 3300017961 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTEAISELKTLYRNCKECFKEDGIVRKIGIIIE |
| Ga0187778_110827002 | 3300017961 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLREAVSELKTLYRNCKECFKEDGI |
| Ga0187776_101318352 | 3300017966 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTQAISELKTLFRNCKECFKEDGVVRKIGIIIE |
| Ga0187776_104780981 | 3300017966 | Tropical Peatland | MRIFLESEVYWFEDFKVDNLAEAISELKILYRNCKECFKEDGIARKIGIIIE |
| Ga0187780_100028057 | 3300017973 | Tropical Peatland | MRIFLESEEYWFENFRVDNLTQAISELKILYRNCKECFKEDGIVRKIGIIIE |
| Ga0187780_103183281 | 3300017973 | Tropical Peatland | WFEDFKVDNLREAISELKTLYKNCSECFKEDGIVRKIGIIIE |
| Ga0187780_103675142 | 3300017973 | Tropical Peatland | FVSLVLFLRKGWKMRIFLESEEYWFEDFKVDNLREAVSELKTLYRNCKECFKEDGIVRKIGIIME |
| Ga0187865_11285692 | 3300018004 | Peatland | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE |
| Ga0187787_100855222 | 3300018029 | Tropical Peatland | MRIFLESEEYWFEDFKVDDLTEAISTLKALYRDCKECFKEDGIVRKIGILIE |
| Ga0187787_101964872 | 3300018029 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTQAIPELKTLYRNCKESFKEDGIVRKIGIIIE |
| Ga0187788_100055222 | 3300018032 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTQAISELKTLFRNCKECFKEDGIVRKIGIIIE |
| Ga0187788_100859512 | 3300018032 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTEAISKLKALYRDCRECFKEDGIARKIGIIIE |
| Ga0187766_101248203 | 3300018058 | Tropical Peatland | MRIFLESEEYWFENFRVDNLTQAISELKILYRNCKQCFKEDGIVRKIGIIIE |
| Ga0187784_100183258 | 3300018062 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTQAISELKTLYRDCKEAFKEDGVVRKIGIIVEQYRA |
| Ga0187784_100842782 | 3300018062 | Tropical Peatland | MRIFLESQEFWFEDFKVDNLTEAISELKTLYRNCKECFKEDAIVRKIGIIIE |
| Ga0187784_104311552 | 3300018062 | Tropical Peatland | MRIFLESEEYWFENFKVDNLTQAISELKILYRNCKECFKEDGIVRKIGIIIE |
| Ga0187773_100805023 | 3300018064 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTEAISKLKALYRDCKECFKEDGIARKIGIIIE |
| Ga0187773_104210541 | 3300018064 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTQAISELQALYRECKECFKEDGFVRKIGIIIE |
| Ga0187769_100988853 | 3300018086 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLREAISELKTLYRNCKECFKEDGIIHKIGIIIE |
| Ga0187771_100210145 | 3300018088 | Tropical Peatland | MRIFLESEEYWFEDFTVDNLTEATSKLKALYRDCKEYFKEDGIARKIGIIIE |
| Ga0187771_101244853 | 3300018088 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTQAMSELKTLYRNCKESFKEDGIVRKIGIIIE |
| Ga0187771_104673132 | 3300018088 | Tropical Peatland | FLESEEFWFEDFKVDNLTQAISELKTLYRNCKECFEEDGIPRRIGIIIE |
| Ga0187771_109071502 | 3300018088 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLTEAISELKTLYRNCKECFKEDGIVRKIGIIIE |
| Ga0187774_107241692 | 3300018089 | Tropical Peatland | MRIFLESEEYWFEDFKVDNLTQAISELKSLYRDCKESFKEDGIVRKIGVIIE |
| Ga0187770_112821031 | 3300018090 | Tropical Peatland | MRIFLESEEFWFEDFKVDNLRGAISELKTLYRNCKECFKEDGIARKIGII |
| Ga0194111_103060531 | 3300020083 | Freshwater Lake | SGEMRIFLESDEYWFEDFKVDNLKEAISELKALHRDCKEAFKEDGIVRKIGIIVE |
| Ga0194111_106528723 | 3300020083 | Freshwater Lake | MRIFLESEEYWFEDFKVDNLMEAISKLKALYGDCKECFKEDGIVRKIGIIIE |
| Ga0194110_100606884 | 3300020084 | Freshwater Lake | MRIFLESDEYWFEDFKVDNLKEAISELKALHRDCKEAFKEDGIVRKIGIIVE |
| Ga0194110_102354564 | 3300020084 | Freshwater Lake | MRIFLESEEYWFEDFKVDNLMEAISKLKALYQDCKEAFKEDGIARKVGIIIE |
| Ga0194125_108029111 | 3300020222 | Freshwater Lake | FLESDEYWFEDFKVDNLKEAISELKALHRDCKEAFKEDGIVRKIGIIVE |
| Ga0224495_104272842 | 3300022208 | Sediment | MRIFLESEEYWFEDFKVDNLSEAISELKALYRDCKECFEEDGIVRKIGIIIE |
| Ga0212089_105208052 | 3300022551 | Lake Sediment | MRIFLESEEYWFEDFKVDNLTQAIYELKALYRDCKESFKEDGIVRKIGIIIE |
| (restricted) Ga0233423_101828492 | 3300023177 | Freshwater | VRIFLESEEYWFEDFKVDNLTDAISKLKALYRDCKECFKEDGIARKIGIVIE |
| Ga0209721_10334871 | 3300025104 | Hot Spring | MRIFLESEEFWFEDFKVDNLMEAISKLKALYRDCRECFKEDRIVRKIGIIIE |
| Ga0209164_100074147 | 3300027690 | Enrichment Culture | MRIFLESEEFWFEDFKVDNLTAAISQLKALYRDCKDSFKEDGIVRKIGIIIE |
| Ga0209703_12330021 | 3300027723 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIDRKIGVIIE |
| Ga0209592_10306852 | 3300027731 | Freshwater Sediment | MRIFLESEEYWFEDFKVDNLTQAISELRALYRDCKESFKEDGIVRKIGVIIE |
| Ga0209592_10467441 | 3300027731 | Freshwater Sediment | KMRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIDRKIGVIIE |
| Ga0256868_103975431 | 3300027811 | Soil | MRIFLESEEYWFEDFRVDNLTQAISELKALYRDCKECFKEDGIVRKIGVIIE |
| Ga0209293_103681782 | 3300027877 | Wetland | MRIFLESEEYWFEDFKVDNLTEAISKLKVLYRDCKDCFKEDGIVRKIGVIIE |
| Ga0209253_100080885 | 3300027900 | Freshwater Lake Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKALYRHCKESFKEDGIVRKIGVIIE |
| Ga0299915_106451011 | 3300030613 | Soil | MRIFLESEEYWFEDFRVDNLTQAISELKALYRDCKECFKEDGI |
| (restricted) Ga0315308_13353981 | 3300031587 | Sediment | MRIFLESEEYWFEDFKVDNLTQAICELKALYQDCKECFKEDGIV |
| Ga0315291_111590451 | 3300031707 | Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKALYRNCKESFKEDGIVRKIGVIIE |
| (restricted) Ga0315306_101173791 | 3300031806 | Sediment | FEQGGEKMRIFLESEEYWFEDFKVDNLTQAISELKTLYRNCKECFKEDGIVRKIGIIIE |
| (restricted) Ga0315306_103336532 | 3300031806 | Sediment | MRIFLESEEYWFEDFKVDNLTQAICELKALYQDCKECFKEDGIVRKIGVIIE |
| (restricted) Ga0315310_101773951 | 3300031876 | Sediment | MRIFLESEEYWFEDFKVDNLSEAISELRALYRDCRE |
| (restricted) Ga0315310_102698902 | 3300031876 | Sediment | MRIFLESEEYWFEDFKVDNLTQAISELKTLYRNCKECFKEDGI |
| (restricted) Ga0315314_10212673 | 3300031877 | Sediment | MRIFLESEEYWFEDFKVDNLRQAISELKALYRDCRECFKEDGIVRKIGIIIE |
| Ga0335085_101180034 | 3300032770 | Soil | MRIFLESEEYWFEDFKVDSLPQAISELKALYRNCKECFKEDGIVRKIGIIIE |
| Ga0335070_1000007168 | 3300032829 | Soil | MRIFLESEEYWFEEFKVDNLTEAISELKTLYRNCKECFKEDGIARKIGIIIE |
| Ga0335070_100224824 | 3300032829 | Soil | VLFLRKGVKKMRIFLKSEVYWFEDFKVDNLTQAISELKTLYRNCKECFKEDGIVRKIGVIIE |
| Ga0335070_100545171 | 3300032829 | Soil | MRIFLESEEFWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE |
| Ga0335070_101290634 | 3300032829 | Soil | MRIFLESEVYWFEDFKVDNLTEAISELKTLYRNCKEC |
| Ga0335081_101455911 | 3300032892 | Soil | MRIFLESEEFWFEDFKVDNLTQAISELKTLYRNCKECFKEDGIARKIGIIIE |
| Ga0335081_101588432 | 3300032892 | Soil | MRIFLESEEYWFEDFKVDNLTQAISELKTLYRNCKEAFEEDGVVRKIGVIIE |
| Ga0326728_100043058 | 3300033402 | Peat Soil | MRIFLESEEYWFEDLKVENLTQAISELKALYRNCKEAFEEDGVVRKIGVIIE |
| Ga0316603_106419253 | 3300033413 | Soil | MRIFLESEEYWFKDFRVDNLTQAISELKALYRDCKECFKDDGIVRKIGIIIE |
| Ga0326726_1001239210 | 3300033433 | Peat Soil | MRIFLESEEFWFEDFKVDNLTEAISKLKALYRDCKECFKEDGIARKIGIIIE |
| Ga0326726_100645963 | 3300033433 | Peat Soil | MRIFLESEEYWFEDFKVDNLTQAISELKTLYRNCKEAFKEDGVVRKIGVIIE |
| Ga0316620_100801703 | 3300033480 | Soil | MRIFLESEEYWFEDFKVDNLTQAISELRALYRDCKESFKEDGIIRKIGVIIE |
| Ga0316624_115369422 | 3300033486 | Soil | MRIFLESEEYWFEDFKVDNLRQAISELKALYRDCEECFKEDGIVRKIGVIIE |
| Ga0299912_100377537 | 3300033489 | Soil | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGVVRKIGVIIE |
| Ga0316628_1000380593 | 3300033513 | Soil | MRIFLESEEYWFEDFKVDNLAQAISELRALYRDCEECFKEDGIVRKIGLIIE |
| Ga0316628_1004511442 | 3300033513 | Soil | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKECFKEDGIVRKIGIVIE |
| Ga0316628_1007214662 | 3300033513 | Soil | VFKEGGEKVRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVRKIGVIIE |
| Ga0316628_1022300812 | 3300033513 | Soil | FLESEEFWFEDFKVDNLTQAISELKALYRDCKECFKEDGIVRKIGVIIE |
| Ga0316628_1029825461 | 3300033513 | Soil | MRIFLESEEYWFEDFKVHNLTEAISKLKALYRDCKECLKEDGIARKIGIIIE |
| Ga0316628_1043910931 | 3300033513 | Soil | MRIFLESEEYWFEDFKVDNLTQAISELKALYRDCKESFKEDGIVSKIGVIIE |
| Ga0314863_022888_895_1053 | 3300033804 | Peatland | MRIFLESEEFWFEDFKVDNLTQAISELKTLYRNCKEAFKEDGVVRKIGVIIE |
| Ga0314866_045866_124_282 | 3300033807 | Peatland | MRIFLESEEFWFEDFKVDSLTQAISELKALYRDCKECLKEDGIVRKIGIVIE |
| Ga0314861_0037388_2027_2185 | 3300033977 | Peatland | MRIFLESEEFWFEDFKVDNLTEAISELKTLYRNCKECFKEDAIVRKIGIIIE |
| Ga0334965_0133933_573_731 | 3300033991 | Sediment | MRIFLESEEYWFEDFKVDNLTEAISELKALYRDCKECFKEDGIVRKIGVIIE |
| Ga0334965_0351775_177_344 | 3300033991 | Sediment | MRIFLESEEYWFEDFKVDNLKEAISQLKTLYRNCKESFKEDGIVRKIGIIIEIIE |
| Ga0326723_0346272_2_178 | 3300034090 | Peat Soil | KERGGKMRIFLESEEYWFEDFKVDNLTEAISKLKALYRDCRESFKEDGIVRKIGVIIE |
| ⦗Top⦘ |