


| Basic Information | |
|---|---|
| Family ID | F095572 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MGALPSADGSTGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.29 % |
| % of genes near scaffold ends (potentially truncated) | 11.43 % |
| % of genes from short scaffolds (< 2000 bps) | 79.05 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand (20.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.810 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.048 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.77% β-sheet: 0.00% Coil/Unstructured: 58.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01494 | FAD_binding_3 | 70.48 |
| PF13191 | AAA_16 | 0.95 |
| PF17164 | DUF5122 | 0.95 |
| PF07728 | AAA_5 | 0.95 |
| PF03795 | YCII | 0.95 |
| PF13376 | OmdA | 0.95 |
| PF01475 | FUR | 0.95 |
| PF00107 | ADH_zinc_N | 0.95 |
| PF00903 | Glyoxalase | 0.95 |
| PF01636 | APH | 0.95 |
| PF00665 | rve | 0.95 |
| PF02371 | Transposase_20 | 0.95 |
| PF02661 | Fic | 0.95 |
| PF01590 | GAF | 0.95 |
| PF00239 | Resolvase | 0.95 |
| PF07087 | DUF1353 | 0.95 |
| PF11716 | MDMPI_N | 0.95 |
| PF01872 | RibD_C | 0.95 |
| PF08241 | Methyltransf_11 | 0.95 |
| PF07555 | NAGidase | 0.95 |
| PF00361 | Proton_antipo_M | 0.95 |
| PF02899 | Phage_int_SAM_1 | 0.95 |
| PF03466 | LysR_substrate | 0.95 |
| PF00849 | PseudoU_synth_2 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 140.95 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 70.48 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 70.48 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 70.48 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.95 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.95 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.95 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.95 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.95 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.95 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.95 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.38 % |
| Unclassified | root | N/A | 7.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005177|Ga0066690_10306820 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005178|Ga0066688_10239935 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005471|Ga0070698_100768468 | Not Available | 907 | Open in IMG/M |
| 3300005559|Ga0066700_10509670 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005559|Ga0066700_10609167 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005560|Ga0066670_10148813 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300005586|Ga0066691_10364802 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005586|Ga0066691_10890518 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006031|Ga0066651_10223402 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300006050|Ga0075028_100997489 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006057|Ga0075026_100043160 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300006059|Ga0075017_100028357 | All Organisms → cellular organisms → Bacteria | 3676 | Open in IMG/M |
| 3300006059|Ga0075017_100044496 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300006162|Ga0075030_100425709 | Not Available | 1058 | Open in IMG/M |
| 3300006354|Ga0075021_10778057 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006796|Ga0066665_10760848 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006797|Ga0066659_10734959 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006797|Ga0066659_11556947 | Not Available | 554 | Open in IMG/M |
| 3300006800|Ga0066660_10547326 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300007255|Ga0099791_10360740 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300009012|Ga0066710_103590749 | Not Available | 585 | Open in IMG/M |
| 3300009137|Ga0066709_103144426 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009815|Ga0105070_1076419 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010042|Ga0126314_11118631 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010321|Ga0134067_10461151 | Not Available | 520 | Open in IMG/M |
| 3300010335|Ga0134063_10320526 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010336|Ga0134071_10220450 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300010379|Ga0136449_100487492 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300012042|Ga0136627_1198690 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012043|Ga0136631_10005585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4296 | Open in IMG/M |
| 3300012043|Ga0136631_10049304 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300012045|Ga0136623_10245663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300012091|Ga0136625_1210901 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012183|Ga0136624_1030150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → unclassified Euzebyaceae → Euzebyaceae bacterium | 2120 | Open in IMG/M |
| 3300012183|Ga0136624_1080327 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300012183|Ga0136624_1252033 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012189|Ga0137388_11322697 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012198|Ga0137364_10593621 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012201|Ga0137365_10566162 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012202|Ga0137363_11134026 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012205|Ga0137362_11037994 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012208|Ga0137376_10167245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1896 | Open in IMG/M |
| 3300012208|Ga0137376_11078506 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012210|Ga0137378_11542836 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012349|Ga0137387_10503052 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012363|Ga0137390_10253314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1746 | Open in IMG/M |
| 3300012527|Ga0136633_1003322 | All Organisms → cellular organisms → Bacteria | 10646 | Open in IMG/M |
| 3300012527|Ga0136633_1288336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium avium → Mycobacterium avium subsp. avium → Mycobacterium avium subsp. avium 11-4751 | 596 | Open in IMG/M |
| 3300012530|Ga0136635_10123395 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012678|Ga0136615_10198485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | 919 | Open in IMG/M |
| 3300012680|Ga0136612_10014287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3942 | Open in IMG/M |
| 3300012684|Ga0136614_10026730 | All Organisms → cellular organisms → Bacteria | 4280 | Open in IMG/M |
| 3300012684|Ga0136614_10359087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1071 | Open in IMG/M |
| 3300012925|Ga0137419_11618626 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012927|Ga0137416_10514560 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300012927|Ga0137416_11261212 | Not Available | 667 | Open in IMG/M |
| 3300012929|Ga0137404_11511399 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012944|Ga0137410_11286576 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300014501|Ga0182024_12486223 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300015245|Ga0137409_10293516 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300015358|Ga0134089_10560941 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300015359|Ga0134085_10096033 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300017695|Ga0180121_10010280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3416 | Open in IMG/M |
| 3300017787|Ga0183260_10046441 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
| 3300017787|Ga0183260_10796042 | Not Available | 592 | Open in IMG/M |
| 3300017789|Ga0136617_10109380 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
| 3300017789|Ga0136617_10146023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2020 | Open in IMG/M |
| 3300017789|Ga0136617_10190541 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300017789|Ga0136617_10699965 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300017822|Ga0187802_10298220 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300018000|Ga0184604_10233994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Actinomarinicola → Actinomarinicola tropica | 640 | Open in IMG/M |
| 3300018027|Ga0184605_10493611 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018433|Ga0066667_11488089 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300018466|Ga0190268_10587656 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300018468|Ga0066662_10790869 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300021080|Ga0210382_10168189 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300025324|Ga0209640_10718928 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300026325|Ga0209152_10299167 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300026331|Ga0209267_1317376 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026550|Ga0209474_10393178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300027636|Ga0214469_1048622 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300027638|Ga0208612_1093143 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027638|Ga0208612_1100084 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027681|Ga0208991_1137930 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300027894|Ga0209068_10006590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5469 | Open in IMG/M |
| 3300027902|Ga0209048_10062641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2981 | Open in IMG/M |
| 3300027903|Ga0209488_10171096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1641 | Open in IMG/M |
| 3300027911|Ga0209698_10305530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1258 | Open in IMG/M |
| 3300028536|Ga0137415_10028508 | All Organisms → cellular organisms → Bacteria | 5501 | Open in IMG/M |
| 3300028824|Ga0307310_10084340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
| 3300030006|Ga0299907_10001070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15032 | Open in IMG/M |
| 3300030006|Ga0299907_10049522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3338 | Open in IMG/M |
| 3300030006|Ga0299907_10704412 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300030517|Ga0272420_1026812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3512 | Open in IMG/M |
| 3300030524|Ga0311357_10689469 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300030619|Ga0268386_10078701 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
| 3300030620|Ga0302046_10434895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
| 3300031228|Ga0299914_10372806 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300031229|Ga0299913_10678097 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031454|Ga0272427_1016053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium avium → Mycobacterium avium subsp. avium → Mycobacterium avium subsp. avium 11-4751 | 5844 | Open in IMG/M |
| 3300031576|Ga0247727_10000576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 89966 | Open in IMG/M |
| 3300031965|Ga0326597_11721885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | 591 | Open in IMG/M |
| 3300033407|Ga0214472_10553034 | Not Available | 1062 | Open in IMG/M |
| 3300033417|Ga0214471_10969179 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300034760|Ga0334948_089514 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 20.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.29% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.95% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012183 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030517 | Rock endolithic microbial communities from Victoria Land, Antarctica - Battleship Promontory nord | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034760 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 44SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066690_103068202 | 3300005177 | Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGARSLGARWLSLSGAAFAGERR* |
| Ga0066688_102399352 | 3300005178 | Soil | MRVLPSADGSSGSAEPVEELAGRMRATGAGARSLGARWLSLSGAAFAGERR* |
| Ga0070698_1007684682 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDALPSADGSSGSAEPVEELAGRMRAAGARARSLCARWLSPSGA |
| Ga0066700_105096702 | 3300005559 | Soil | MGALSSADGSTGSAEPVEEFAGRVRAIGAGARSLCARWLSLSGAAFAGERR* |
| Ga0066700_106091672 | 3300005559 | Soil | ADGSSGSAEPVEELAGRMRATGAGARSLGARWLSLSGAAFAGERR* |
| Ga0066670_101488133 | 3300005560 | Soil | MDALSSADGSTGSAEPVEELAGRVRASGGGARSLCARWLSLCGAGFAGERR* |
| Ga0066691_103648023 | 3300005586 | Soil | MGALSSADGSTGSAEPVEELAGRVRAIGAGARSLCARWLSLSGAAFAGERR* |
| Ga0066691_108905182 | 3300005586 | Soil | MRVLPSADESSGSAEPVEELAGRMRATGAGARSLGARWLSLSGAAFAGERR* |
| Ga0066651_102234021 | 3300006031 | Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSLCARWLSLSGAAFAGERR* |
| Ga0075028_1009974892 | 3300006050 | Watersheds | MGVLSWVDGSTGNAEPVEEAAGRMRTTGAGAWSLGARRLTLSGAGFARERR* |
| Ga0075026_1000431602 | 3300006057 | Watersheds | MGALRSADGSTGSAEPVEELAGRMWATGAGARSLCARWLSLSCAAFAGERR* |
| Ga0075017_1000283572 | 3300006059 | Watersheds | MGAMASVDGSTGSAEPVEEVAARVRATRAGVPSLDARWLSVSGAAFAGERR* |
| Ga0075017_1000444963 | 3300006059 | Watersheds | MRVVRSGVGSSGSAEPVEELAGTMPETGPGARSLGASRLPRSAAAFAGERR* |
| Ga0075030_1004257092 | 3300006162 | Watersheds | MGVVRSAGGSTGSAEPVEESAESVRLTGAGARVFGAGWLSLCGARFAGARR* |
| Ga0075021_107780571 | 3300006354 | Watersheds | TSGAGSCGMGAMASVDGSTGSAEPVEEVAARVRATRAGVPSLDARWLSVSGAAFAGERR* |
| Ga0066665_107608482 | 3300006796 | Soil | MGVLPSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR* |
| Ga0066659_107349592 | 3300006797 | Soil | MDALSSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR* |
| Ga0066659_115569471 | 3300006797 | Soil | MGALPSADVSTRSAERVDELAVRVRATGAGARSLCARWLSLSSAAFARE |
| Ga0066660_105473262 | 3300006800 | Soil | MRVLPSADGSSGSAEPVEELAGRVRASGGGARSLCARWLSLSGAVFAAERR* |
| Ga0099791_103607401 | 3300007255 | Vadose Zone Soil | MYAFSSADGSTGSAEPVEELAGRMRATGAGSRSLCARWVSLSGAAFAGERR* |
| Ga0066710_1035907492 | 3300009012 | Grasslands Soil | MDALSSADGSTGSAEAVEELAGRVRATGAGARSLCARWLSLSGA |
| Ga0066709_1031444262 | 3300009137 | Grasslands Soil | MGAFLSADGSTGSAEPVDELAGRVRATGAGARSLCARWLSLSGAALPGEQR* |
| Ga0105070_10764191 | 3300009815 | Groundwater Sand | MRVLPSADGSTGSAEPVEELAGRVRATGAGARSLCARWLSLSGAAFAGARR* |
| Ga0126314_111186311 | 3300010042 | Serpentine Soil | MGALLSDGSTGSAEPVEELAGPVRATGAGAPSLGARWLSLSGAAFAGEQR* |
| Ga0134067_104611512 | 3300010321 | Grasslands Soil | MRVLPSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR* |
| Ga0134063_103205261 | 3300010335 | Grasslands Soil | MDALSSADGSTGSAEPVEELAGRVRATGAGLRSLCARWLSLSGAAFAGERR* |
| Ga0134071_102204502 | 3300010336 | Grasslands Soil | MDALSSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFGGERR* |
| Ga0136449_1004874923 | 3300010379 | Peatlands Soil | MRVLPSADGSSGSAEPVEAWAARVPAAGADAPSPCGRWRSLSGAASAGEQR* |
| Ga0136627_11986902 | 3300012042 | Polar Desert Sand | MGVLLSADGSSGSAEPVEELAGRRVTGAGARSLCAGWLSLSGAAFGGERR* |
| Ga0136631_100055853 | 3300012043 | Polar Desert Sand | MGVLLSASRSSESAEPVEELAGRRVTRAGARSLRAGWLSLSGAAFGGERR* |
| Ga0136631_100493042 | 3300012043 | Polar Desert Sand | MRVLTRADGSSGSAEPVEELAGRTRETGAGARSLCASWLPLSGAAFAGERH* |
| Ga0136623_102456631 | 3300012045 | Polar Desert Sand | MRVLPSADGSSGSAEPVEELAGRVRATRAGARSLCARWLSLSGATFA |
| Ga0136625_12109011 | 3300012091 | Polar Desert Sand | LSADGSSGSAEPVEELAARVRAAGAGGRSLGARWLSLSGAAFAGERR* |
| Ga0136624_10301502 | 3300012183 | Polar Desert Sand | MRVLPSADGSTGSAEPVEDLAGKMRTTGAGARSLCARWLSLSGAAFAGERR* |
| Ga0136624_10803272 | 3300012183 | Polar Desert Sand | MRVLPSADGSSGSGEPVEELAGKMRATDAGARSLCARWLSRAAFAGERR* |
| Ga0136624_12520332 | 3300012183 | Polar Desert Sand | MGVLLSADGWSGSAEPVEELAGRRVTGAGARSLCAGWLSLSGAAFGGERR* |
| Ga0137388_113226971 | 3300012189 | Vadose Zone Soil | ALSSADGSTGSAEPVEELAGRVRATGVGERSLCARWLSLSGAAFAGERR* |
| Ga0137364_105936211 | 3300012198 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSLGARWLSLSGAAFAGERR* |
| Ga0137365_105661622 | 3300012201 | Vadose Zone Soil | MDALSSADGSTGSTEPVEELAGRMRATGAGSRSLGARWLSSSGAAFAGERR* |
| Ga0137363_111340261 | 3300012202 | Vadose Zone Soil | MDALSSADGSTGSAEAVEELAGRVRATGAGWRSLGARWLSLSGAAFAGERR* |
| Ga0137362_110379942 | 3300012205 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSLCARWVSLSGAAFAGERR* |
| Ga0137376_101672452 | 3300012208 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSLGARWLSLSGAAFAGEWR* |
| Ga0137376_110785062 | 3300012208 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGARSLGARWVSLSGAAFAGERR* |
| Ga0137378_115428361 | 3300012210 | Vadose Zone Soil | MGGLLSADGSTGSAEAVEELAGRMWATGAGARSLSLSGAVFAGER* |
| Ga0137387_105030522 | 3300012349 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGAPLLSTSGAVFAGER* |
| Ga0137390_102533142 | 3300012363 | Vadose Zone Soil | MRVLPSADGSTGSAEPVEELAARMRATSAGARSLCARGLSLSGAAFAGQGR* |
| Ga0136633_100332210 | 3300012527 | Polar Desert Sand | MRVSIWADGSSGSAEPVEESAGRTRPTGAGARSLGASWLPLSGAAFAGERH* |
| Ga0136633_12883362 | 3300012527 | Polar Desert Sand | DGSSGSGEPVEELAGKMRATDAGARSLCARWLSRAAFAGERR* |
| Ga0136635_101233952 | 3300012530 | Polar Desert Sand | MRVLRSADGSTGSAEPVEELAARVRATGAGERPPCARWLSLFGATLAGERR* |
| Ga0136615_101984852 | 3300012678 | Polar Desert Sand | MDALSSADRSTGSAEPVEELAGRMRATGAGARSLRARWQSLSGAAFAGERR* |
| Ga0136612_100142872 | 3300012680 | Polar Desert Sand | MGASLSADGSTGSAEPVEESMARVRATGAGARSLCARWLSLSGAAFAGDRR* |
| Ga0136614_100267304 | 3300012684 | Polar Desert Sand | MGVLLSEDGSNGSAEPVEELAGRLRPTGAGEPSHCARWPSLFGAAFAGERR* |
| Ga0136614_103590873 | 3300012684 | Polar Desert Sand | MGALSLADRSTGSAEPVEKLAGGRVTGAGARSLCAGWL |
| Ga0137419_116186262 | 3300012925 | Vadose Zone Soil | MDALSSADGSTGNAEPVEELAGRMRPTGAGSRSLCARWLSLSGAAFAGERR* |
| Ga0137416_105145602 | 3300012927 | Vadose Zone Soil | MDALSSAGGSTESAEPVEELAGRMRATGADSRSLCARWLSLSGAAFAGERR* |
| Ga0137416_112612121 | 3300012927 | Vadose Zone Soil | MGALLSADGSTGSAEPVEELAVRVRATGAGRRSLGARWLWLSGAAFAGERR* |
| Ga0137404_115113991 | 3300012929 | Vadose Zone Soil | MDALSSADGSSGSAEPVEELAARVRATGAGARSLCARWLSLSGAAFAGERR* |
| Ga0137410_112865762 | 3300012944 | Vadose Zone Soil | MDALSSADGSTGSPEPVEELAGRMRATGAGARSLGARWLPPSGAAFAGERR* |
| Ga0182024_124862232 | 3300014501 | Permafrost | MSVLSSADEWSGSDEPQPAEDLAGRTEATGAGARSLGARWLLLSGKAFAGQRR* |
| Ga0137409_102935162 | 3300015245 | Vadose Zone Soil | MRALPSADGSTGSAEPVEELAGRVRATGAGSRSLCARWLSLSGAAFAGERR* |
| Ga0134089_105609412 | 3300015358 | Grasslands Soil | MGVLPSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERP* |
| Ga0134085_100960332 | 3300015359 | Grasslands Soil | MDALSSADGSTGSAEPVEELAGRVRATGAGARSLCARWLSLSGAAFAGERR* |
| Ga0180121_100102804 | 3300017695 | Polar Desert Sand | MGVLLSASRSSESAEPVEELAGRRVTRAGARSLRAGWLSLSGAAFGGERR |
| Ga0183260_100464412 | 3300017787 | Polar Desert Sand | MGALLSADGSSGSAEPVEELAARVRAAGAGGRSLGARWLSLSGAAFAGERR |
| Ga0183260_107960422 | 3300017787 | Polar Desert Sand | MGVLPSADGSTGSAEPAEELAGRVWATGAGAPWPGARGLSLSDGAVAGERR |
| Ga0136617_101093802 | 3300017789 | Polar Desert Sand | MRVLPSADGSSGSGEPAEELAGRMRATDAGARSLCARWLSPAAFAGERR |
| Ga0136617_101460231 | 3300017789 | Polar Desert Sand | MDALSSADGSTGSAEPVEELVARVRATGAGARSLCARWLSLSGAAFAG |
| Ga0136617_101905412 | 3300017789 | Polar Desert Sand | MRVLPSADGSTGSAEPVEELAARVRATGARARALCARWRSLSGAAFAGERR |
| Ga0136617_106999651 | 3300017789 | Polar Desert Sand | MRVLRSADGSTGSAEPVEELAARVRATGAGERPPCARWLSLSGATLAGERR |
| Ga0187802_102982201 | 3300017822 | Freshwater Sediment | MRVLPSADGSGGSAEPVEELAGRMRATGAGAPSLCARWLSLSGAAFGERR |
| Ga0184604_102339941 | 3300018000 | Groundwater Sediment | MGALLSADGSTGSAEPVEELAGRVRATGAGARSLCGRWLSPSGAAFAGERR |
| Ga0184605_104936111 | 3300018027 | Groundwater Sediment | MRVLPSADGSSGSAEPVEEFAGRMQATGAGARSLCARWLSLSGAAFAGERR |
| Ga0066667_114880892 | 3300018433 | Grasslands Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSLCARWLSLSGAAFAGERR |
| Ga0190268_105876561 | 3300018466 | Soil | SGAGSTASAEPVEESAGRMRATGAVARALGVRWLSLSGAAFAGERR |
| Ga0066662_107908692 | 3300018468 | Grasslands Soil | MGVLPSADGSSGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERP |
| Ga0210382_101681893 | 3300021080 | Groundwater Sediment | MRVLPSADGSSGSAEPVEELTGRTRATGAGARSLCARWLPLSGAAFAGERR |
| Ga0209640_107189281 | 3300025324 | Soil | MRVSPSADGSSGSAEPVEELAGRMRATGAGARWLCARWLSLSGAAFAGER |
| Ga0209152_102991673 | 3300026325 | Soil | MGALLSADGSTGSAEPVDELAARVRATGAGARSLCARWLSLSGSALAGEQR |
| Ga0209267_13173762 | 3300026331 | Soil | MRVLPSADGSSGSAEPVEELAGRMRATGAGARSLGARWLSLSGAAFAGERR |
| Ga0209474_103931782 | 3300026550 | Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGSRSFCARWVSLSGAAFAGERR |
| Ga0214469_10486222 | 3300027636 | Soil | MDALLSADPSSRGAEPVEELGGRMRATGAAVWVGARSLCARWLSVSGAAFAGERR |
| Ga0208612_10931431 | 3300027638 | Polar Desert | MRVLPSADGSTGSAEPVEDLAGKMRTTGAGARSLCARWLSLSGAAFAGERR |
| Ga0208612_11000842 | 3300027638 | Polar Desert | MGVLLSADGSSGSAEPVEELAGRRVTGAGARSLCAGWLSLSGAAFGGERR |
| Ga0208991_11379301 | 3300027681 | Forest Soil | MGALPSADGSTGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR |
| Ga0209068_100065905 | 3300027894 | Watersheds | MGAMASVDGSTGSAEPVEEVAARVRATRAGVPSLDARWLSVSGAAFAGERR |
| Ga0209048_100626412 | 3300027902 | Freshwater Lake Sediment | MGALSSVDGSTGSAEPVEDLAGRVWATGTGAWSLCARWLSLSGAAFDGERR |
| Ga0209488_101710962 | 3300027903 | Vadose Zone Soil | MDALLSADGSTGSAEPVEELAARVRATGAGARSLCARWLSLSGAAFAGEQR |
| Ga0209698_103055301 | 3300027911 | Watersheds | MGALLSAGGSTESAEPVEESAERVRVTGAGARLFGARWLSLPGARFAGARR |
| Ga0137415_100285082 | 3300028536 | Vadose Zone Soil | MDALSSADGSTGSAEPVEELAGRMRATGAGARSLCARWLSLSGAAFAGERR |
| Ga0307310_100843403 | 3300028824 | Soil | MGALLSADGSTGSAEPVEELAGRVRATGAGARSLCARWLSLSGAAFAGERR |
| Ga0299907_1000107014 | 3300030006 | Soil | MGALLSAVGSTGSTESVEELAGRVRATGAGARSLRARWLSLSGAAFAGERR |
| Ga0299907_100495224 | 3300030006 | Soil | MRVLPSAEGSSGSAGPVEELAARVRATGAGARSLWARWLPLSGAALAGERR |
| Ga0299907_107044121 | 3300030006 | Soil | MRVLPSADGSSGSAEPEPVEELAGRMGATGAGARSLCAKRLSLSGAAIAGERR |
| Ga0272420_10268124 | 3300030517 | Rock | MDALSSADGSTGSAEPVEELAGRVRAIGSGARPLCARWLSLSGTAFAGERQ |
| Ga0311357_106894692 | 3300030524 | Palsa | MRVLLSADGSSVSIEPEPAEDLAGRMRATGAGARFLCPGWLYPSRAPFAGERR |
| Ga0268386_100787012 | 3300030619 | Soil | MRVLPSADGPSGSAEPVEELAGRVPVTGAPLFARWLSLSGAAFAGGSR |
| Ga0302046_104348951 | 3300030620 | Soil | MRVLPSVDGSSGSAEPVEELAARMRATGAGVRPLGARGLSLSGAAFAGERR |
| Ga0299914_103728062 | 3300031228 | Soil | MDALLSADPSSRGAEPVEELGGRMRATGAAVWVGARSLCARWLSLSGAAFAGERR |
| Ga0299913_106780971 | 3300031229 | Soil | MGALRSADRATGSTEPVETLATRVRATADARPCCAWWLSLSGAGFAGERR |
| Ga0272427_10160534 | 3300031454 | Rock | MRVLSSTDGSTGCPEPVEELAGRMRATGAGSRSFGARWPSLSGAASAGERR |
| Ga0247727_1000057617 | 3300031576 | Biofilm | MNALSSEEPRTGCAEGVEELAGRVRAAGAGSGSGCAKRLSLSGAAFGGEHQ |
| Ga0326597_117218851 | 3300031965 | Soil | MRVLPSADGWSGSAEPEQVEELAGRVRATGAGARSLCARWLSLSGAAFAGERR |
| Ga0214472_105530342 | 3300033407 | Soil | MPVLPSADGSSGSAEPVEELAGRMRATGPGARSLCARWLSLSVTAFAGERR |
| Ga0214471_109691791 | 3300033417 | Soil | MRVLPWEDGSCEAAEVVELAGRMRPTGAGAHLLGAWWLSLSGEVFAGERR |
| Ga0334948_089514_153_308 | 3300034760 | Sub-Biocrust Soil | MGVLPSADGSTGSAEPVEELAGRVRTTGAGGRSLGARWLSLSGASFAEQRR |
| ⦗Top⦘ |