


| Basic Information | |
|---|---|
| Family ID | F095436 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.90 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (26.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 0.00% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 61.90 |
| PF05378 | Hydant_A_N | 6.67 |
| PF02653 | BPD_transp_2 | 0.95 |
| PF13379 | NMT1_2 | 0.95 |
| PF01315 | Ald_Xan_dh_C | 0.95 |
| PF03404 | Mo-co_dimer | 0.95 |
| PF02538 | Hydantoinase_B | 0.95 |
| PF00589 | Phage_integrase | 0.95 |
| PF01546 | Peptidase_M20 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 61.90 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 61.90 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 13.33 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.24 % |
| Unclassified | root | N/A | 4.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JBQ7T | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300000955|JGI1027J12803_103937381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300004463|Ga0063356_103712627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300004633|Ga0066395_10095795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
| 3300004633|Ga0066395_10598910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300004635|Ga0062388_102793862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300005332|Ga0066388_100550579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans | 1783 | Open in IMG/M |
| 3300005332|Ga0066388_101439371 | Not Available | 1200 | Open in IMG/M |
| 3300005332|Ga0066388_103162580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
| 3300005332|Ga0066388_104146845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300005445|Ga0070708_101844699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300005552|Ga0066701_10183309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans | 1277 | Open in IMG/M |
| 3300005559|Ga0066700_10177600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans | 1459 | Open in IMG/M |
| 3300005713|Ga0066905_100002161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7197 | Open in IMG/M |
| 3300005713|Ga0066905_101421495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300005713|Ga0066905_102198580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_101474424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1283 | Open in IMG/M |
| 3300005764|Ga0066903_105133297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300005764|Ga0066903_105705887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300005764|Ga0066903_107077059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300006047|Ga0075024_100115159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300006578|Ga0074059_10008966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300006880|Ga0075429_100425565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
| 3300006903|Ga0075426_10346196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300007788|Ga0099795_10299409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300009792|Ga0126374_11805546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300010043|Ga0126380_12149176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300010046|Ga0126384_11783675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300010047|Ga0126382_10121729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121 | 1732 | Open in IMG/M |
| 3300010047|Ga0126382_11591337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300010048|Ga0126373_11377419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300010048|Ga0126373_12588851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300010358|Ga0126370_10241306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1395 | Open in IMG/M |
| 3300010358|Ga0126370_10425443 | Not Available | 1099 | Open in IMG/M |
| 3300010359|Ga0126376_12310610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300010360|Ga0126372_10849683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300010361|Ga0126378_12053647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300010361|Ga0126378_12776697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300010362|Ga0126377_11462774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300010362|Ga0126377_12062948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300010366|Ga0126379_10265090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1702 | Open in IMG/M |
| 3300010366|Ga0126379_11700878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300010366|Ga0126379_13854675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300010376|Ga0126381_100353273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2033 | Open in IMG/M |
| 3300010376|Ga0126381_102676740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300010379|Ga0136449_100531769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2029 | Open in IMG/M |
| 3300010398|Ga0126383_10087144 | Not Available | 2747 | Open in IMG/M |
| 3300010398|Ga0126383_10168163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2068 | Open in IMG/M |
| 3300010398|Ga0126383_13456394 | Not Available | 516 | Open in IMG/M |
| 3300010868|Ga0124844_1272169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300011270|Ga0137391_10997931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300012096|Ga0137389_10837515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300012189|Ga0137388_10807935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300012189|Ga0137388_11663650 | Not Available | 573 | Open in IMG/M |
| 3300012971|Ga0126369_12325137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300012971|Ga0126369_13197058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300012971|Ga0126369_13412724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300016319|Ga0182033_11223328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300016341|Ga0182035_10838367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
| 3300016371|Ga0182034_10799752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300016387|Ga0182040_11462941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300016404|Ga0182037_11515079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300016445|Ga0182038_11005571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300016445|Ga0182038_12089462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300021479|Ga0210410_11702130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300021560|Ga0126371_10353208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1606 | Open in IMG/M |
| 3300021560|Ga0126371_13763169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300025910|Ga0207684_10507684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1033 | Open in IMG/M |
| 3300027854|Ga0209517_10628025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300027874|Ga0209465_10134931 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300027874|Ga0209465_10337342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300027875|Ga0209283_10197643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1336 | Open in IMG/M |
| 3300027915|Ga0209069_10050182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1962 | Open in IMG/M |
| 3300030013|Ga0302178_10540051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300031545|Ga0318541_10168734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1206 | Open in IMG/M |
| 3300031561|Ga0318528_10003895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. J32 | 6269 | Open in IMG/M |
| 3300031572|Ga0318515_10110893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1445 | Open in IMG/M |
| 3300031640|Ga0318555_10008155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4477 | Open in IMG/M |
| 3300031682|Ga0318560_10252354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300031723|Ga0318493_10898497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300031747|Ga0318502_10392770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300031764|Ga0318535_10141204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
| 3300031769|Ga0318526_10350970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300031771|Ga0318546_10217917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1307 | Open in IMG/M |
| 3300031771|Ga0318546_10667246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300031777|Ga0318543_10068168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1485 | Open in IMG/M |
| 3300031779|Ga0318566_10012811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3541 | Open in IMG/M |
| 3300031821|Ga0318567_10360384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300031821|Ga0318567_10799076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031835|Ga0318517_10255176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300031859|Ga0318527_10530034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300031860|Ga0318495_10256731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300031890|Ga0306925_12197470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300031893|Ga0318536_10213628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300031902|Ga0302322_103287450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300031902|Ga0302322_103533225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300031959|Ga0318530_10237980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300031981|Ga0318531_10421597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300032010|Ga0318569_10278586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300032025|Ga0318507_10327629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300032063|Ga0318504_10376262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300032089|Ga0318525_10244938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
| 3300032094|Ga0318540_10246390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
| 3300032160|Ga0311301_10479720 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300032261|Ga0306920_102558557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 15.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_07169380 | 2170459003 | Grass Soil | AERFDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| JGI1027J12803_1039373811 | 3300000955 | Soil | SKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0063356_1037126272 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0066395_100957951 | 3300004633 | Tropical Forest Soil | HEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS* |
| Ga0066395_105989102 | 3300004633 | Tropical Forest Soil | DMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0062388_1027938621 | 3300004635 | Bog Forest Soil | MSKYMTNEQTLQYLYALREKTVPVYSHSYAGRPPVPNSGKE* |
| Ga0066388_1005505793 | 3300005332 | Tropical Forest Soil | MSKYMSNQEVIDYLYKLREKTVPIYSHSYAGRPPVADKK* |
| Ga0066388_1014393711 | 3300005332 | Tropical Forest Soil | ETFDMSKYMTNEQTLHYLRALREKTVPVYSHSYAGRPPVPDGGKE* |
| Ga0066388_1031625801 | 3300005332 | Tropical Forest Soil | KYMSNKDVVEYLYRLREKTVPVYSHSYAGRPPVADKPKE* |
| Ga0066388_1041468451 | 3300005332 | Tropical Forest Soil | DMVHHEKFDMSKYMTNEQILHYLRGLREKTVPVYSHSYAGRPPVPEGEKE* |
| Ga0070708_1018446992 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RFDMSKYMSNREVIDYLCKLREKTVPVYSHSYAGRPPVPDKK* |
| Ga0066701_101833093 | 3300005552 | Soil | LGDMVHEERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE* |
| Ga0066700_101776001 | 3300005559 | Soil | ERFDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0066905_1000021613 | 3300005713 | Tropical Forest Soil | MSKYMNNREVIDYLYRLREKTVPVYSHSYAGRPPVADKK* |
| Ga0066905_1014214952 | 3300005713 | Tropical Forest Soil | HAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKTEE* |
| Ga0066905_1021985801 | 3300005713 | Tropical Forest Soil | VHAERFDMSKYMTNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE* |
| Ga0066903_1014744241 | 3300005764 | Tropical Forest Soil | VHREKFDMAKYMTNEQVLQYLYRLREKTVPVYSHSYTGRPPVPDAGKKE* |
| Ga0066903_1051332972 | 3300005764 | Tropical Forest Soil | TNEQCLKYLYALREKTVPVYSHSYTGRPPLPDGGKG* |
| Ga0066903_1057058871 | 3300005764 | Tropical Forest Soil | FDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKTEE* |
| Ga0066903_1070770591 | 3300005764 | Tropical Forest Soil | MVHHEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS* |
| Ga0075024_1001151592 | 3300006047 | Watersheds | EKFDMSKYMSNEQVIQYLYGLREKTVPVYSHSYAGRPPAPNDGKE* |
| Ga0074059_100089662 | 3300006578 | Soil | VHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0075429_1004255651 | 3300006880 | Populus Rhizosphere | YMSNKDVVEYLYRLREKTVPVYSHSYAGRPPVADKPKE* |
| Ga0075426_103461961 | 3300006903 | Populus Rhizosphere | SNEQVIHYLYSLREKTVPVYSHSYAGRPPAPEAGKT* |
| Ga0099795_102994091 | 3300007788 | Vadose Zone Soil | EQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGKA* |
| Ga0126374_118055462 | 3300009792 | Tropical Forest Soil | YMTNEQCLKYLYALREKTVPVYSHSYTGRPPLPDGGKE* |
| Ga0126380_121491762 | 3300010043 | Tropical Forest Soil | DMVHHEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDADKT* |
| Ga0126384_117836752 | 3300010046 | Tropical Forest Soil | YMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE* |
| Ga0126382_101217292 | 3300010047 | Tropical Forest Soil | MSKYINNREVIDYLYRLREKTVPVYSHSYAGRPPVADKK* |
| Ga0126382_115913371 | 3300010047 | Tropical Forest Soil | MSKYMSNKDVVEYLYRLREKTVPVYSHSYAGRPPVADKPKE* |
| Ga0126373_113774192 | 3300010048 | Tropical Forest Soil | ERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPAPDKAEE* |
| Ga0126373_125888512 | 3300010048 | Tropical Forest Soil | HEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPD* |
| Ga0126370_102413061 | 3300010358 | Tropical Forest Soil | DDMVHHEKFDLSKYMTNEQVVKYLYGLREKTVPVYSHSYTGRPPVPDGGKG* |
| Ga0126370_104254431 | 3300010358 | Tropical Forest Soil | PLEDMVHYETFDMSKYMTNEQTLHYLRALREKTVPVYSHSYAGRPPVPDGGKE* |
| Ga0126376_123106102 | 3300010359 | Tropical Forest Soil | DMVHHEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS* |
| Ga0126372_108496831 | 3300010360 | Tropical Forest Soil | SKYMSNREVIEYLYRLRERTVPVYSHSYAGRPPVPDKAEE* |
| Ga0126378_120536471 | 3300010361 | Tropical Forest Soil | MSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0126378_127766971 | 3300010361 | Tropical Forest Soil | PLADMVHAERFDMSKYMSNREVIEYLYGLREKTVPLYSHSYAGRPPIPDKAEE* |
| Ga0126377_114627741 | 3300010362 | Tropical Forest Soil | MSNKDVVEYLYRLREKTVPVYSHSYAGRPPVADKPKE* |
| Ga0126377_120629482 | 3300010362 | Tropical Forest Soil | DDMVHHEKFDMSKYMTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGNG* |
| Ga0126379_102650901 | 3300010366 | Tropical Forest Soil | MSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDADKK* |
| Ga0126379_117008781 | 3300010366 | Tropical Forest Soil | LDDMVHHEKFDMSKYMTNEQVVKYLYGLREKTVPVYSHSYTGRPPVPDGEKG* |
| Ga0126379_138546751 | 3300010366 | Tropical Forest Soil | REVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE* |
| Ga0126381_1003532731 | 3300010376 | Tropical Forest Soil | KYMSNEEVIRYLYSLREKTVPVYSHSYAGRPPVPDTGKA* |
| Ga0126381_1026767402 | 3300010376 | Tropical Forest Soil | HEKFDMAKYMSNEEVIRYLYSLREKTVPVYSHSYAGRPPVPDTGKA* |
| Ga0136449_1005317692 | 3300010379 | Peatlands Soil | MVHRERYEMSKYMTNEQVVKYLYDLREKTVPVYGHFTSGRPGVRDQT* |
| Ga0126383_100871441 | 3300010398 | Tropical Forest Soil | EQTLHYLRGLREKTVPVYSHSYAGRPPMPDGGKE* |
| Ga0126383_101681633 | 3300010398 | Tropical Forest Soil | EKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS* |
| Ga0126383_134563942 | 3300010398 | Tropical Forest Soil | KYMTNEQVLKYLYALREKTVPVYSHSYTGRPPVPDAGKE* |
| Ga0124844_12721691 | 3300010868 | Tropical Forest Soil | EERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDK* |
| Ga0137391_109979313 | 3300011270 | Vadose Zone Soil | DDMVHHEKFDMSKYMTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGKE* |
| Ga0137389_108375151 | 3300012096 | Vadose Zone Soil | MVHHEKFDMSKYMTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGKA* |
| Ga0137388_108079352 | 3300012189 | Vadose Zone Soil | HHEKFDMSKYMTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGKK* |
| Ga0137388_116636501 | 3300012189 | Vadose Zone Soil | EKFDMSKYMTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDRGKE* |
| Ga0126369_123251371 | 3300012971 | Tropical Forest Soil | MTNEQVLKYLYGLREKTVPVYSHSYTGRPPVPDGGKG* |
| Ga0126369_131970582 | 3300012971 | Tropical Forest Soil | SNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS* |
| Ga0126369_134127241 | 3300012971 | Tropical Forest Soil | EQCLKYLYALREKTVPVYSHSYTGRPPLPGGGKG* |
| Ga0182033_112233281 | 3300016319 | Soil | HAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0182035_108383671 | 3300016341 | Soil | PLEDMVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0182034_107997522 | 3300016371 | Soil | LEDMVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0182040_114629412 | 3300016387 | Soil | AERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0182037_115150791 | 3300016404 | Soil | RPLEDMVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0182038_110055712 | 3300016445 | Soil | SKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAQE |
| Ga0182038_120894621 | 3300016445 | Soil | EQALQYLYALREKTVPVYSHSYAGRPPVPDTGQPAGGKG |
| Ga0210410_117021301 | 3300021479 | Soil | EDMVHAERFDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0126371_103532081 | 3300021560 | Tropical Forest Soil | DMVHHEKFDMSKYMSNEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKS |
| Ga0126371_137631691 | 3300021560 | Tropical Forest Soil | NEQVIRYLYSLREKTVPVYSHSYAGRPPVPDAGKK |
| Ga0207684_105076842 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0209517_106280251 | 3300027854 | Peatlands Soil | NEQVLQYLYALREKTVPVYSHSYAGRPPTPLPKGSE |
| Ga0209465_101349311 | 3300027874 | Tropical Forest Soil | HYDKFDMTKYMSNEEVIRYLYALREKTVPVYSHSYAGRPPVPDPGKA |
| Ga0209465_103373422 | 3300027874 | Tropical Forest Soil | AERFDISKYMSNREVIEYLYRLREKTMPVYSHSYAGRPPVPDKAEE |
| Ga0209283_101976433 | 3300027875 | Vadose Zone Soil | KYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0209069_100501821 | 3300027915 | Watersheds | MSKYMSNEQVIQYLYGLREKTVPVYSHSYTGRPPAPHDGKE |
| Ga0302178_105400512 | 3300030013 | Palsa | DKFDMSKYMTNEQILHYLHGLREKTVPVYSHSYAGRPPVPDGGKE |
| Ga0318541_101687341 | 3300031545 | Soil | DMVHRDRFDMSKYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| Ga0318528_100038956 | 3300031561 | Soil | VHAERFDMSKYMSNREVVEYLYRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318515_101108931 | 3300031572 | Soil | RPLEDMVHRDRFDMSKYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| Ga0318555_100081554 | 3300031640 | Soil | HRPLGDMVHEERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318560_102523541 | 3300031682 | Soil | DMVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318493_108984972 | 3300031723 | Soil | YMSNREVVEYLYRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318502_103927702 | 3300031747 | Soil | LEDMVHAERFDMSKYMSNREVIEYLYGLREKTVPLYSHSYAGRPPIPDKAEE |
| Ga0318535_101412041 | 3300031764 | Soil | MSKYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| Ga0318526_103509702 | 3300031769 | Soil | SKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318546_102179171 | 3300031771 | Soil | DMVHEERFDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318546_106672462 | 3300031771 | Soil | NREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAQE |
| Ga0318543_100681681 | 3300031777 | Soil | ERFDLSKYMSNREVIEYLCRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318566_100128111 | 3300031779 | Soil | HEERFDLSKYMSNREVIEYLCRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0318567_103603842 | 3300031821 | Soil | LEDMVHAERFDMSKYLSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318567_107990761 | 3300031821 | Soil | VHAERFDVSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAQE |
| Ga0318517_102551762 | 3300031835 | Soil | RFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318527_105300342 | 3300031859 | Soil | VHCDRFDMSKYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| Ga0318495_102567311 | 3300031860 | Soil | EDMVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0306925_121974702 | 3300031890 | Soil | MVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPAPDKAKE |
| Ga0318536_102136281 | 3300031893 | Soil | RPLGDMVHEERFDLSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0302322_1032874501 | 3300031902 | Fen | MTNEQILQYLRALREKTVPVYSHSYAGRPPVPQDGGGR |
| Ga0302322_1035332252 | 3300031902 | Fen | NEQTLQYLYALREKTVPVYSHSYAGRPPVPDGGKG |
| Ga0318530_102379802 | 3300031959 | Soil | EMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318531_104215972 | 3300031981 | Soil | RPLEDMVHAERFDVSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAQE |
| Ga0318569_102785861 | 3300032010 | Soil | DRVHAERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318507_103276292 | 3300032025 | Soil | ERFDMSKYMSNREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318504_103762622 | 3300032063 | Soil | KYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| Ga0318525_102449381 | 3300032089 | Soil | NREVIEYLYRLREKTVPVYSHSYAGRPPVPDKAEE |
| Ga0318540_102463901 | 3300032094 | Soil | DIVHEERFDLSKYMSNREVIEYLCRLREKTVPVYSHSYAGRPPVPDKAKE |
| Ga0311301_104797202 | 3300032160 | Peatlands Soil | MVHRERYEMSKYMTNEQVVKYLYDLREKTVPVYGHFTSGRPGVRDQT |
| Ga0306920_1025585571 | 3300032261 | Soil | SKYMTNEQTLQYLYALREKTVPVYSHSYQGRPPVSDGGKE |
| ⦗Top⦘ |