


| Basic Information | |
|---|---|
| Family ID | F095431 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.62 % |
| % of genes near scaffold ends (potentially truncated) | 17.14 % |
| % of genes from short scaffolds (< 2000 bps) | 79.05 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.524 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.952 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00034 | Cytochrom_C | 48.57 |
| PF00116 | COX2 | 23.81 |
| PF00115 | COX1 | 3.81 |
| PF00510 | COX3 | 2.86 |
| PF00344 | SecY | 1.90 |
| PF13442 | Cytochrome_CBB3 | 0.95 |
| PF13795 | HupE_UreJ_2 | 0.95 |
| PF04545 | Sigma70_r4 | 0.95 |
| PF02545 | Maf | 0.95 |
| PF01058 | Oxidored_q6 | 0.95 |
| PF03626 | COX4_pro | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 23.81 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 23.81 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 2.86 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 1.90 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.95 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.95 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.95 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.95 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.52 % |
| Unclassified | root | N/A | 10.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104639657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium | 639 | Open in IMG/M |
| 3300003267|soilL1_10185795 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300005093|Ga0062594_100749252 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005093|Ga0062594_101321915 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005175|Ga0066673_10621254 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005330|Ga0070690_100276284 | Not Available | 1197 | Open in IMG/M |
| 3300005332|Ga0066388_103260840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300005340|Ga0070689_100002893 | All Organisms → cellular organisms → Bacteria | 11293 | Open in IMG/M |
| 3300005343|Ga0070687_100396448 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005440|Ga0070705_101601569 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005441|Ga0070700_101207629 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 632 | Open in IMG/M |
| 3300005467|Ga0070706_101130475 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005526|Ga0073909_10047718 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300005535|Ga0070684_100209830 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300005713|Ga0066905_100008167 | All Organisms → cellular organisms → Bacteria | 4750 | Open in IMG/M |
| 3300005764|Ga0066903_100088734 | All Organisms → cellular organisms → Bacteria | 4092 | Open in IMG/M |
| 3300005764|Ga0066903_100254415 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300005764|Ga0066903_100393401 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300005764|Ga0066903_102596186 | Not Available | 982 | Open in IMG/M |
| 3300005764|Ga0066903_102952612 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005831|Ga0074471_10658597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium | 563 | Open in IMG/M |
| 3300005833|Ga0074472_10684763 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005840|Ga0068870_11180771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 553 | Open in IMG/M |
| 3300006580|Ga0074049_12817060 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006606|Ga0074062_12052776 | Not Available | 1030 | Open in IMG/M |
| 3300006755|Ga0079222_10165707 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300006844|Ga0075428_100196397 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300006845|Ga0075421_101735511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium | 674 | Open in IMG/M |
| 3300006852|Ga0075433_10142043 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300006852|Ga0075433_11620654 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006853|Ga0075420_100575688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 972 | Open in IMG/M |
| 3300006853|Ga0075420_101014769 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → unclassified Verrucomicrobiae → Verrucomicrobiae bacterium | 714 | Open in IMG/M |
| 3300006854|Ga0075425_100257196 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300006854|Ga0075425_101223947 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006871|Ga0075434_100535241 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300006880|Ga0075429_100005516 | All Organisms → cellular organisms → Bacteria | 10893 | Open in IMG/M |
| 3300006904|Ga0075424_101446658 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006914|Ga0075436_100199470 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300006914|Ga0075436_101072225 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006953|Ga0074063_13177246 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300007076|Ga0075435_101117862 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009089|Ga0099828_11057066 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009094|Ga0111539_10749684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
| 3300009147|Ga0114129_11623782 | Not Available | 791 | Open in IMG/M |
| 3300009225|Ga0103851_1000293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005 | 4979 | Open in IMG/M |
| 3300009235|Ga0103857_10147329 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010359|Ga0126376_11334329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 739 | Open in IMG/M |
| 3300010359|Ga0126376_12195632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 597 | Open in IMG/M |
| 3300010361|Ga0126378_10704844 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300010366|Ga0126379_10047482 | All Organisms → cellular organisms → Bacteria | 3511 | Open in IMG/M |
| 3300010401|Ga0134121_10044647 | All Organisms → cellular organisms → Bacteria | 3628 | Open in IMG/M |
| 3300011444|Ga0137463_1115565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300012358|Ga0137368_10352899 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012397|Ga0134056_1018896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 575 | Open in IMG/M |
| 3300012918|Ga0137396_10586164 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012948|Ga0126375_11715250 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300015245|Ga0137409_10311640 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300015245|Ga0137409_11041750 | Not Available | 656 | Open in IMG/M |
| 3300015371|Ga0132258_10431181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3283 | Open in IMG/M |
| 3300018083|Ga0184628_10432381 | Not Available | 686 | Open in IMG/M |
| 3300018433|Ga0066667_11982765 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018469|Ga0190270_11382768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300019458|Ga0187892_10015094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8464 | Open in IMG/M |
| 3300024232|Ga0247664_1027508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
| 3300024254|Ga0247661_1009116 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300024254|Ga0247661_1086779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 588 | Open in IMG/M |
| 3300024254|Ga0247661_1119634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 503 | Open in IMG/M |
| 3300024298|Ga0255178_1081736 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300025906|Ga0207699_10609472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 795 | Open in IMG/M |
| 3300025918|Ga0207662_10210859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1261 | Open in IMG/M |
| 3300025930|Ga0207701_10041150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4297 | Open in IMG/M |
| 3300025936|Ga0207670_10000052 | All Organisms → cellular organisms → Bacteria | 86188 | Open in IMG/M |
| 3300026075|Ga0207708_10355051 | Not Available | 1204 | Open in IMG/M |
| 3300026118|Ga0207675_100086573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2942 | Open in IMG/M |
| 3300026562|Ga0255285_1028784 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300027787|Ga0209074_10151726 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027874|Ga0209465_10220260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 948 | Open in IMG/M |
| 3300027880|Ga0209481_10002741 | All Organisms → cellular organisms → Bacteria | 7302 | Open in IMG/M |
| 3300027880|Ga0209481_10454367 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027903|Ga0209488_10913935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 614 | Open in IMG/M |
| 3300027907|Ga0207428_10089400 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
| 3300027909|Ga0209382_10556103 | Not Available | 1255 | Open in IMG/M |
| 3300028380|Ga0268265_10651863 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300028802|Ga0307503_10283027 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031170|Ga0307498_10066218 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10136029 | Not Available | 671 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1204162 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031538|Ga0310888_10103740 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300031538|Ga0310888_10111818 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300031543|Ga0318516_10057591 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300031719|Ga0306917_10590310 | Not Available | 873 | Open in IMG/M |
| 3300031740|Ga0307468_100619552 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031820|Ga0307473_10451963 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031879|Ga0306919_11394199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 529 | Open in IMG/M |
| 3300031908|Ga0310900_10094907 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300031943|Ga0310885_10855178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 519 | Open in IMG/M |
| 3300032064|Ga0318510_10341395 | Not Available | 630 | Open in IMG/M |
| 3300032076|Ga0306924_10451082 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300032122|Ga0310895_10608405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 561 | Open in IMG/M |
| 3300032144|Ga0315910_10709336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 781 | Open in IMG/M |
| 3300032174|Ga0307470_11211199 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032180|Ga0307471_101379439 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300032261|Ga0306920_100104435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4196 | Open in IMG/M |
| 3300033412|Ga0310810_10145563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2760 | Open in IMG/M |
| 3300034664|Ga0314786_148326 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 19.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.95% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1046396572 | 3300000364 | Soil | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFXLR* |
| soilL1_101857953 | 3300003267 | Sugarcane Root And Bulk Soil | MAGDGFEEGWAENTAKVTFIMTVVGVILFVGSVFWFILN* |
| Ga0062594_1007492522 | 3300005093 | Soil | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILR* |
| Ga0062594_1013219152 | 3300005093 | Soil | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFILR* |
| Ga0066673_106212542 | 3300005175 | Soil | MAGDGFEPDWDVNTARMTMRFTVLGVLLFVGCVMLFILR* |
| Ga0070690_1002762842 | 3300005330 | Switchgrass Rhizosphere | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVACVFLFILR* |
| Ga0066388_1032608402 | 3300005332 | Tropical Forest Soil | MAGDGFEEDWAANTARWTMRFTVLGVLLFVGCVFLFILR* |
| Ga0070689_1000028933 | 3300005340 | Switchgrass Rhizosphere | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIMR* |
| Ga0070687_1003964482 | 3300005343 | Switchgrass Rhizosphere | MAGEHFEDDWANNTARWTMRFTVLGVVLFVGCVFLFIFR* |
| Ga0070705_1016015692 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDGFEPDWDVNTARWTMRFTVLGVVLFVGCVMLFIFK* |
| Ga0070700_1012076291 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDGFDEKWAAETAKLTVIYTVVGVVLFVGSVFLFIFPEGTPR* |
| Ga0070706_1011304751 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILK* |
| Ga0073909_100477183 | 3300005526 | Surface Soil | MAGDGFDDDWADSTARYTFIFTVVGVVLFVAAVFLFIF* |
| Ga0070684_1002098303 | 3300005535 | Corn Rhizosphere | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR* |
| Ga0066905_1000081675 | 3300005713 | Tropical Forest Soil | MAGDGFEPDWAEKTARLTFIFTIVGVVLFVGSVFVFIML* |
| Ga0066903_1000887346 | 3300005764 | Tropical Forest Soil | MAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF* |
| Ga0066903_1002544151 | 3300005764 | Tropical Forest Soil | MAGDGFEEDWAVNTARWTMIFAVLGVVLFVGCVFLFIL* |
| Ga0066903_1003934015 | 3300005764 | Tropical Forest Soil | MAGDGFEKDWDLNTARWTMRFTILGVVLFVGSVFVFILR* |
| Ga0066903_1025961862 | 3300005764 | Tropical Forest Soil | MAGDGFEENWATNTARWTMRFTVLGVVLFVGCVFLFILR* |
| Ga0066903_1029526122 | 3300005764 | Tropical Forest Soil | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR* |
| Ga0074471_106585972 | 3300005831 | Sediment (Intertidal) | MAGDGFEEGWAENTARTTFIFTVLGVVLFVGAVFLFIY* |
| Ga0074472_106847632 | 3300005833 | Sediment (Intertidal) | MAGDGFESDWADKTAKLTFLFTVVGVVLFVGAVMLFIF* |
| Ga0068870_111807711 | 3300005840 | Miscanthus Rhizosphere | MAGDGFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK* |
| Ga0074049_128170602 | 3300006580 | Soil | MAGDGFEENWAADTARWTMRFTVLGVLLFVGCVFLFILR* |
| Ga0074062_120527761 | 3300006606 | Soil | MAGDGFEDDWADSTAKYTFIFTVVGVVLFVAAVFL |
| Ga0079222_101657072 | 3300006755 | Agricultural Soil | MAGDGFEEDWANNTARWTMRFTVLGVALFVGCVFLFIFR* |
| Ga0075428_1001963973 | 3300006844 | Populus Rhizosphere | MAGDGFEPDWANQTARWTMLFTVVGVVLFVACVFLFIF* |
| Ga0075421_1017355112 | 3300006845 | Populus Rhizosphere | MAGDGFEEGWAEHTAKVTFIFTVLGVVLFVGSVFLFIF* |
| Ga0075433_101420433 | 3300006852 | Populus Rhizosphere | MAGDGFEEGWANNTARWTMIFTLLGVVLFVACVFLFIY* |
| Ga0075433_116206542 | 3300006852 | Populus Rhizosphere | PRMAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFIF* |
| Ga0075420_1005756881 | 3300006853 | Populus Rhizosphere | MAGDGFDEKWADNTARLTFIYTVVGVVLFVGSVFLF |
| Ga0075420_1010147692 | 3300006853 | Populus Rhizosphere | MAGDGFEEGWAENTAKVTFIFTVVGVVLFVGSVFLFIF* |
| Ga0075425_1002571962 | 3300006854 | Populus Rhizosphere | MAGDGFEENWAINTARWTMIFAVIGVVLFVACVFLFIF* |
| Ga0075425_1012239472 | 3300006854 | Populus Rhizosphere | MAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFVF* |
| Ga0075434_1005352412 | 3300006871 | Populus Rhizosphere | MAGDGFEEEWALNTARWTMIFTVVGVVLFVACVFLFIF* |
| Ga0075429_1000055163 | 3300006880 | Populus Rhizosphere | MAGDGFDEKWADHTAKLTFIYTVVGVVLFVGSVFLFIL* |
| Ga0075424_1014466582 | 3300006904 | Populus Rhizosphere | MAGDGFEENWATDTARWTMRFTVLGVLLFVGCVFLFILR* |
| Ga0075436_1001994702 | 3300006914 | Populus Rhizosphere | MAGDGFEEDWANNTARWTMRLTVLGVVLFVGSVFLFILR* |
| Ga0075436_1010722252 | 3300006914 | Populus Rhizosphere | VAGEHFEDDWADTTAKWTFILTVVSVVLFVGAVFLFIF* |
| Ga0074063_131772462 | 3300006953 | Soil | MAGDGFEDDWADSTAKYTFIFTVVGVVLFVAAVFLFIF* |
| Ga0075435_1011178622 | 3300007076 | Populus Rhizosphere | EHFEDDWADTTAKWTFILTVVSVVLFVGAVFLFIF* |
| Ga0099828_110570662 | 3300009089 | Vadose Zone Soil | MAGDGFDDDWADSIARYTFIFTVVGVVLFVAAVFLFIF* |
| Ga0111539_107496842 | 3300009094 | Populus Rhizosphere | MAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFLFIFPEGTPR* |
| Ga0114129_116237821 | 3300009147 | Populus Rhizosphere | MAGDGFEEGWAVNTARWTMIFTVVGVVLFVACVFLFIY* |
| Ga0103851_10002937 | 3300009225 | River Water | MAGDGFDAKWADDTARWTFILTVLGVVLFVGAVFLFIF* |
| Ga0103857_101473292 | 3300009235 | River Water | MAGDGFDEKWAMDTARWTFIYTAIGVVLFVGAVFLFIF* |
| Ga0126376_113343292 | 3300010359 | Tropical Forest Soil | MAGDGFDEGWANNTARWTMRFTVLGVVLFVGCVFLFIFR* |
| Ga0126376_121956323 | 3300010359 | Tropical Forest Soil | MAGDGFEEEWALNTARWTMIFAVLGVVLFVGCVFLFIM* |
| Ga0126378_107048442 | 3300010361 | Tropical Forest Soil | MAGDGFEEDWANNTARWTMRFTLLGVVLFVGCVFLFILR* |
| Ga0126379_100474824 | 3300010366 | Tropical Forest Soil | MAGDGFEEGWAENTARWTMRFTVLGVVLFVGSVFLFILR* |
| Ga0134121_100446473 | 3300010401 | Terrestrial Soil | MAGDGFEEGWADNTARWTMRFTVLGVVLFVGSVFLFILR* |
| Ga0137463_11155652 | 3300011444 | Soil | MAGDGFDEKWAEQTAKLTFIYTAVGVVLFVGCVFLFIFPEGTPR* |
| Ga0137368_103528992 | 3300012358 | Vadose Zone Soil | MAGDGFEEDWAIHTARWTMVFTVLGVVLFVACVFLFIY* |
| Ga0134056_10188961 | 3300012397 | Grasslands Soil | MAGDGFEEGWANNTARWTMIFTVVGVVLFVACVFLFIF* |
| Ga0137396_105861642 | 3300012918 | Vadose Zone Soil | MAGDGFDEDWADSVAKYTFIFTVVSVVLFVAAVFLFIF* |
| Ga0126375_117152501 | 3300012948 | Tropical Forest Soil | GRRMAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF* |
| Ga0137409_103116402 | 3300015245 | Vadose Zone Soil | VAGDGFEDNWAETTARWTVILTVVGVVLFVGCVFLFIF* |
| Ga0137409_110417502 | 3300015245 | Vadose Zone Soil | VAGDKFDDDWADKTAKWTFLYTVVGVVAFLIAVFVWIF* |
| Ga0132258_104311812 | 3300015371 | Arabidopsis Rhizosphere | MAGDGFEEHWADNTARWTMRFTVLGVLLFVGCVFLFIFR* |
| Ga0184628_104323811 | 3300018083 | Groundwater Sediment | MAGDGFDEKWAEQTAKLTFIYTLVGVVLFVGSVFLFIFPEGTPR |
| Ga0066667_119827652 | 3300018433 | Grasslands Soil | GREPTMAGDGFDDDWADSTAKYTFIFTVVGVVLFVAAVFLFIF |
| Ga0190270_113827682 | 3300018469 | Soil | MAGDGFDEKWAEHTAKLTFIYTVVGVVLFVGSVFLFIF |
| Ga0187892_1001509410 | 3300019458 | Bio-Ooze | MAGDGFDEDWAEHTARLTFIFTVVGVALFVGAVFLFIF |
| Ga0247664_10275081 | 3300024232 | Soil | AGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR |
| Ga0247661_10091163 | 3300024254 | Soil | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR |
| Ga0247661_10867792 | 3300024254 | Soil | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Ga0247661_11196343 | 3300024254 | Soil | MAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFL |
| Ga0255178_10817361 | 3300024298 | Freshwater | PSMAGDGFDEKWAHETARLTFIYTVVGVVLFVGAVLLFIR |
| Ga0207699_106094721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDHFEPDWADKTAKWTFLWTVAGVIAFVIAVYVWI |
| Ga0207662_102108592 | 3300025918 | Switchgrass Rhizosphere | MAGEHFEDDWANNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Ga0207701_100411501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDGFEEDWANNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Ga0207670_1000005231 | 3300025936 | Switchgrass Rhizosphere | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFIMR |
| Ga0207708_103550511 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGDGFDEKWAADTAKLTVIYTVVGVVLFVGSVFLFIFPEGTPR |
| Ga0207675_1000865734 | 3300026118 | Switchgrass Rhizosphere | GFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK |
| Ga0255285_10287842 | 3300026562 | Freshwater | MAGDGFDEKWAHETARLTFIYTVVGVVLFVGAVLLFIR |
| Ga0209074_101517262 | 3300027787 | Agricultural Soil | MAGDGFEEDWANNTARWTMRFTVLGVALFVGCVFLFIFR |
| Ga0209465_102202601 | 3300027874 | Tropical Forest Soil | MAGDGFEEEWALNTARWTMIFAVLGVVLFVACVFLFIF |
| Ga0209481_100027417 | 3300027880 | Populus Rhizosphere | MAGDGFDEKWADHTAKLTFIYTVVGVVLFVGSVFLFIL |
| Ga0209481_104543672 | 3300027880 | Populus Rhizosphere | MAGDGFEPDWANQTARWTMLFTVVGVVLFVACVFLFIF |
| Ga0209488_109139352 | 3300027903 | Vadose Zone Soil | VAGDGFEENWADNTARYTFIFTIVGVVLFVGAVFLFIF |
| Ga0207428_100894002 | 3300027907 | Populus Rhizosphere | MAGDGFEEDWAVNTARWTMRFTVLGVVLFVGCVFLFILR |
| Ga0209382_105561032 | 3300027909 | Populus Rhizosphere | MAGDGFEEGWAEHTAKVTFIFTVLGVVLFVGSVFLFIF |
| Ga0268265_106518632 | 3300028380 | Switchgrass Rhizosphere | MAGDGFEEDWAVNTARWTFRFTVLGVILFVGCVFLFILK |
| Ga0307503_102830272 | 3300028802 | Soil | MAGDGFDEKWAAETARLTFIYTAVGVVLFVGCVFLFIFPEGTPR |
| Ga0307498_100662182 | 3300031170 | Soil | MAGDGFDDDWADSTAKYTFIFTVVGVVLFVVCVFLFIF |
| (restricted) Ga0255310_101360292 | 3300031197 | Sandy Soil | MAGDGFEDDWADSTAKVTFIFTVLGVVLFVGAVFLFIF |
| (restricted) Ga0255312_12041622 | 3300031248 | Sandy Soil | MAGDGFEENWAENTAKYTFIFTVVGVVLFVGAVFLFIF |
| Ga0310888_101037403 | 3300031538 | Soil | MAGDGFEEDWAVTTARWTMRFTVLGVVLFVACVFLFIMQ |
| Ga0310888_101118182 | 3300031538 | Soil | MAGDGFDEKWADNTARLTFIYTVVGVVLFVGSVFLFIF |
| Ga0318516_100575913 | 3300031543 | Soil | MAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLFIFR |
| Ga0306917_105903101 | 3300031719 | Soil | MAGDGFEEGWADNTARWTMRFTVLGVVLFVGRVFLFIFR |
| Ga0307468_1006195522 | 3300031740 | Hardwood Forest Soil | MAGDSFEEDWAVNTARWTMRLTVIGVVLFVGCVFLFILR |
| Ga0307473_104519632 | 3300031820 | Hardwood Forest Soil | GFEENWATDTARWTMRFTVLGVLLFVGCVFLFILR |
| Ga0306919_113941992 | 3300031879 | Soil | MAGDGFEEGWADNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Ga0310900_100949073 | 3300031908 | Soil | MAGDGFDEKWADNTAKLTFIYTVVGVVLFVGSVFLFIF |
| Ga0310885_108551782 | 3300031943 | Soil | MAGDGFDEKWAEQTAKLTFIYTVVGVVLFVGSVFLFIFPEGTPR |
| Ga0318510_103413951 | 3300032064 | Soil | MAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLF |
| Ga0306924_104510823 | 3300032076 | Soil | MAGDAFEDDWANTTARWTMRITVLGVVLFVGCVFLFIF |
| Ga0310895_106084052 | 3300032122 | Soil | MAGDGFEEDWAVSTARWTMRLTVLGVVLFVACVFLFIMQ |
| Ga0315910_107093362 | 3300032144 | Soil | MAGDGFEEKWADQTAKLTFIYTIVGVGLFVGSVFLFIF |
| Ga0307470_112111992 | 3300032174 | Hardwood Forest Soil | MAGDGFEENWAADTARWTMRFTVLGVLLFVGCVFLFILR |
| Ga0307471_1013794392 | 3300032180 | Hardwood Forest Soil | MAGDGFEENWAVNTARWTMILTVVGVVLFVGCVFLFIF |
| Ga0306920_1001044351 | 3300032261 | Soil | AGDGFEEGWADNTARWTMRFTVLGVVLFVGCVFLFIFR |
| Ga0310810_101455634 | 3300033412 | Soil | GFEEDWANNTARWTMRFTVLGVVLFVGSVFLFIFR |
| Ga0314786_148326_2_115 | 3300034664 | Soil | EKWAEQTAKLTFIYTIVGVVLFVGSVFLFIFPEGTPR |
| ⦗Top⦘ |