


| Basic Information | |
|---|---|
| Family ID | F095275 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LDLTDAERAAFVARDMRRINELGGYLHLVMSVPGLAAH |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.05 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.048 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 24.76 |
| PF04519 | Bactofilin | 7.62 |
| PF08530 | PepX_C | 6.67 |
| PF13401 | AAA_22 | 3.81 |
| PF01979 | Amidohydro_1 | 2.86 |
| PF16901 | DAO_C | 2.86 |
| PF03061 | 4HBT | 2.86 |
| PF00561 | Abhydrolase_1 | 2.86 |
| PF04879 | Molybdop_Fe4S4 | 1.90 |
| PF13565 | HTH_32 | 1.90 |
| PF03243 | MerB | 1.90 |
| PF00480 | ROK | 1.90 |
| PF07883 | Cupin_2 | 1.90 |
| PF07355 | GRDB | 1.90 |
| PF02515 | CoA_transf_3 | 1.90 |
| PF00106 | adh_short | 0.95 |
| PF01144 | CoA_trans | 0.95 |
| PF00571 | CBS | 0.95 |
| PF13476 | AAA_23 | 0.95 |
| PF09084 | NMT1 | 0.95 |
| PF02900 | LigB | 0.95 |
| PF11249 | DUF3047 | 0.95 |
| PF01048 | PNP_UDP_1 | 0.95 |
| PF00180 | Iso_dh | 0.95 |
| PF07969 | Amidohydro_3 | 0.95 |
| PF04909 | Amidohydro_2 | 0.95 |
| PF05036 | SPOR | 0.95 |
| PF08240 | ADH_N | 0.95 |
| PF03928 | HbpS-like | 0.95 |
| PF02558 | ApbA | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 7.62 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 6.67 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 3.81 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.90 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.95 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.95 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.95 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.95 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.95 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.95 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.95 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.57 % |
| Unclassified | root | N/A | 11.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004013|Ga0055465_10312502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300004157|Ga0062590_102299769 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 567 | Open in IMG/M |
| 3300004463|Ga0063356_105988963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300005174|Ga0066680_10536844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 735 | Open in IMG/M |
| 3300005180|Ga0066685_11083805 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005332|Ga0066388_101780706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1094 | Open in IMG/M |
| 3300005340|Ga0070689_101468061 | Not Available | 617 | Open in IMG/M |
| 3300005353|Ga0070669_101823216 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300005444|Ga0070694_100408523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1064 | Open in IMG/M |
| 3300005446|Ga0066686_10673592 | Not Available | 701 | Open in IMG/M |
| 3300005446|Ga0066686_11111219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300005454|Ga0066687_10393546 | Not Available | 800 | Open in IMG/M |
| 3300005468|Ga0070707_101001639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 801 | Open in IMG/M |
| 3300005535|Ga0070684_100994536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
| 3300005540|Ga0066697_10035556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2778 | Open in IMG/M |
| 3300005540|Ga0066697_10098566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1701 | Open in IMG/M |
| 3300005553|Ga0066695_10659927 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005555|Ga0066692_10298952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300005558|Ga0066698_10182754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1429 | Open in IMG/M |
| 3300005568|Ga0066703_10445119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 776 | Open in IMG/M |
| 3300005587|Ga0066654_10888038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005617|Ga0068859_102529495 | Not Available | 565 | Open in IMG/M |
| 3300006791|Ga0066653_10153158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1125 | Open in IMG/M |
| 3300006847|Ga0075431_101512774 | Not Available | 630 | Open in IMG/M |
| 3300006904|Ga0075424_100711327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1072 | Open in IMG/M |
| 3300006914|Ga0075436_101514622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300007265|Ga0099794_10646033 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009012|Ga0066710_101741260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300009147|Ga0114129_10178235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2893 | Open in IMG/M |
| 3300009147|Ga0114129_13285574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 523 | Open in IMG/M |
| 3300009156|Ga0111538_13391025 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009162|Ga0075423_12676823 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
| 3300009444|Ga0114945_10534540 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009551|Ga0105238_11341071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
| 3300009792|Ga0126374_10883974 | Not Available | 691 | Open in IMG/M |
| 3300009819|Ga0105087_1074651 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300009821|Ga0105064_1037708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 915 | Open in IMG/M |
| 3300010046|Ga0126384_10141765 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300010047|Ga0126382_11516073 | Not Available | 617 | Open in IMG/M |
| 3300010329|Ga0134111_10461789 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010358|Ga0126370_10336285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1214 | Open in IMG/M |
| 3300010358|Ga0126370_10706337 | Not Available | 886 | Open in IMG/M |
| 3300010360|Ga0126372_10085763 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2309 | Open in IMG/M |
| 3300010360|Ga0126372_11220709 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300011270|Ga0137391_10930656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
| 3300011428|Ga0137456_1125709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300012174|Ga0137338_1131072 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012189|Ga0137388_11364239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
| 3300012199|Ga0137383_10140493 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300012202|Ga0137363_11730693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300012203|Ga0137399_10266276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1409 | Open in IMG/M |
| 3300012209|Ga0137379_11413617 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012356|Ga0137371_11202113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300012909|Ga0157290_10083512 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 907 | Open in IMG/M |
| 3300012918|Ga0137396_11300343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300012922|Ga0137394_10004344 | All Organisms → cellular organisms → Bacteria | 10756 | Open in IMG/M |
| 3300012927|Ga0137416_10099402 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300012929|Ga0137404_11063110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300012964|Ga0153916_13173801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 517 | Open in IMG/M |
| 3300012975|Ga0134110_10141786 | Not Available | 989 | Open in IMG/M |
| 3300015245|Ga0137409_11409808 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300015264|Ga0137403_11050923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 661 | Open in IMG/M |
| 3300015359|Ga0134085_10520082 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300015371|Ga0132258_11520717 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300015374|Ga0132255_103133024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300017656|Ga0134112_10102150 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300017659|Ga0134083_10572650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300018028|Ga0184608_10095603 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300018031|Ga0184634_10520532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300018429|Ga0190272_12056338 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300019879|Ga0193723_1153326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300020002|Ga0193730_1010362 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2638 | Open in IMG/M |
| 3300020004|Ga0193755_1201542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 567 | Open in IMG/M |
| 3300020193|Ga0194131_10104321 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300020198|Ga0194120_10151295 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300021418|Ga0193695_1113532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300025569|Ga0210073_1019387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300025904|Ga0207647_10297854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 919 | Open in IMG/M |
| 3300025935|Ga0207709_11235269 | Not Available | 616 | Open in IMG/M |
| 3300025972|Ga0207668_10672948 | Not Available | 908 | Open in IMG/M |
| 3300026309|Ga0209055_1011500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4631 | Open in IMG/M |
| 3300026325|Ga0209152_10125689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 976 | Open in IMG/M |
| 3300026328|Ga0209802_1262630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300026332|Ga0209803_1254516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 605 | Open in IMG/M |
| 3300026360|Ga0257173_1007977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1155 | Open in IMG/M |
| 3300026377|Ga0257171_1039968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
| 3300026524|Ga0209690_1209182 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300026537|Ga0209157_1038471 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300026547|Ga0209156_10134655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300027657|Ga0256865_1090193 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 777 | Open in IMG/M |
| 3300027815|Ga0209726_10096946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1797 | Open in IMG/M |
| 3300027880|Ga0209481_10352554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 751 | Open in IMG/M |
| 3300028587|Ga0247828_10270816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
| 3300028589|Ga0247818_11158856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 551 | Open in IMG/M |
| 3300028597|Ga0247820_10522289 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300028792|Ga0307504_10419726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300028828|Ga0307312_10413323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 887 | Open in IMG/M |
| 3300030006|Ga0299907_10428321 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300031538|Ga0310888_10803848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300031720|Ga0307469_10686764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 926 | Open in IMG/M |
| 3300031820|Ga0307473_11552222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300031949|Ga0214473_10728054 | Not Available | 1078 | Open in IMG/M |
| 3300032783|Ga0335079_11711923 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032954|Ga0335083_10489232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1032 | Open in IMG/M |
| 3300033513|Ga0316628_103719072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.95% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055465_103125021 | 3300004013 | Natural And Restored Wetlands | ADAPAALAGLDLSDAERAAFVARDRRKINELGGYLHLVMSVPGLAAH* |
| Ga0062590_1022997691 | 3300004157 | Soil | ALAGADLSADERAAFVARDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0063356_1059889632 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AEPQAALADVDLSEEERSAFVARDARRINELGGYLHLVMSVPGIAGH* |
| Ga0066680_105368441 | 3300005174 | Soil | EADAGTALAGADLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0066685_110838051 | 3300005180 | Soil | TDPEAALAGADLTEAERAAFMARDMRKVNELGGYLHLVMSIPGLAAH* |
| Ga0066388_1017807062 | 3300005332 | Tropical Forest Soil | ALAGADLSAEERAAFVARDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0070689_1014680611 | 3300005340 | Switchgrass Rhizosphere | AGADLTESERAAFVARDMRRINELGGYLHLVMSIPGHAAH* |
| Ga0070669_1018232161 | 3300005353 | Switchgrass Rhizosphere | LAGLDLTEAERAAFVARDTRKINELGGYLHLVMSVPGLAAH* |
| Ga0070694_1004085233 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAVAGADLTESERAAFVARDMRRINELGGYLHLVMSIPGHAAH* |
| Ga0066686_106735922 | 3300005446 | Soil | PAAVLAGADLSAEERAAFVARDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0066686_111112191 | 3300005446 | Soil | LDLTDAERAAFLARDMQRINALGGYLHLVMSVPGMAAHVTHPEPE* |
| Ga0066687_103935462 | 3300005454 | Soil | TADPAAALAGLDLTEPERSAFIARDMRKINELGGYLHLVMSIPGLAAH* |
| Ga0070707_1010016391 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LADAPSVLAGLDLTEAERAAFIARDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0070684_1009945361 | 3300005535 | Corn Rhizosphere | DAAAALASVDLTEAERAAFVNHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0066697_100355564 | 3300005540 | Soil | LADADLTEAERAAFLARDMRRINELGGYLHLVLSIPGLAVH* |
| Ga0066697_100985664 | 3300005540 | Soil | AERSAFVARDMRRINELGGYLHLVMSIPGLAASQRATT* |
| Ga0066695_106599271 | 3300005553 | Soil | NAERSAFVARDMRRINELGGYLHLVMSIPGLAASQRATT* |
| Ga0066692_102989522 | 3300005555 | Soil | AAFRARDMERINALGGYLHLVMSVPGMAAHVTHTEPE* |
| Ga0066698_101827544 | 3300005558 | Soil | EPERSAFIARDMRKINELGGYLHLVMSIPGLAAH* |
| Ga0066703_104451191 | 3300005568 | Soil | MGPAASIGDLDLTDAERAAFVARDLRKVNELGGYLHLVISIPSLAAR* |
| Ga0066654_108880381 | 3300005587 | Soil | LADADLTEAERAAFLARDMQRINELGGYLHLVLSIPGLAVH* |
| Ga0068859_1025294952 | 3300005617 | Switchgrass Rhizosphere | SRDAAAAVAGADLTESERAAFVARDMRRINELGGYLHLVMSIPGHAAH* |
| Ga0066653_101531581 | 3300006791 | Soil | LSADERAAFAARDMRRINELGGYLHLVLSIPGLAVHPPRH* |
| Ga0075431_1015127741 | 3300006847 | Populus Rhizosphere | RDASAALAGADLSDVERAAFVARDMRAINELGGYLHLVMSIPGLAAH* |
| Ga0075424_1007113273 | 3300006904 | Populus Rhizosphere | DPAAAIVDLDLTADERAAFVARDMRRINELGGYLHLVLSIPGLAIHPPRR* |
| Ga0075436_1015146222 | 3300006914 | Populus Rhizosphere | REPNAALADVDLTDDERAAFIARDARRINELGGFLHLVMSVPGIAGH* |
| Ga0099794_106460331 | 3300007265 | Vadose Zone Soil | DADLTHAERSAFVARDMRRINELGGYLHLVMSIPGLAASQRATT* |
| Ga0066710_1017412601 | 3300009012 | Grasslands Soil | GRDLTDAERAAFLARDMERINALGGYLHLVMSVPGMAAHVMHAEHE |
| Ga0114129_101782353 | 3300009147 | Populus Rhizosphere | DLTDDERAAFIARDARRINELGGFLHLVMSVPGIAGH* |
| Ga0114129_132855741 | 3300009147 | Populus Rhizosphere | ASALAGLDLTEAEQAAFVARDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0111538_133910251 | 3300009156 | Populus Rhizosphere | ADLTEAEREAFVAHDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0075423_126768232 | 3300009162 | Populus Rhizosphere | FDLSDAERAAVLARDLHVLNDLGGYLHLLLSIPGFAPH* |
| Ga0114945_105345402 | 3300009444 | Thermal Springs | ALAGLDLTEDERAAFLARDMRKLNELGGYLHLVMSVPGMAAHVTHADRH* |
| Ga0105238_113410712 | 3300009551 | Corn Rhizosphere | ASVDLTEAERAAFVNHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0126374_108839741 | 3300009792 | Tropical Forest Soil | LTEAERAAFVARDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0105087_10746512 | 3300009819 | Groundwater Sand | LDLTDAERAAFVARDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0105064_10377081 | 3300009821 | Groundwater Sand | DLTEAERAAFVAHDMRKINELGGYLHLVMSIPGLAAHGGRA* |
| Ga0126384_101417654 | 3300010046 | Tropical Forest Soil | VADADLTDAERSAFVARDMRKINELGGYLHLVMSIPGLAAGQHRPT* |
| Ga0126382_115160732 | 3300010047 | Tropical Forest Soil | DLTEAERAAFMARDMRKINELGGYLHLVMSIPGLAAH* |
| Ga0134111_104617892 | 3300010329 | Grasslands Soil | AALAGADLTEAERAAFIARDMRKVNELGGYLHLVMSIPGLAAH* |
| Ga0126370_103362851 | 3300010358 | Tropical Forest Soil | DADLTDAERSAFLARDMRRINELGGYLHLVMSIPGLAAGQHRPT* |
| Ga0126370_107063373 | 3300010358 | Tropical Forest Soil | ADADLDDAERAAFLTRDMRKINELGGYLHLVMSIPGLAAH* |
| Ga0126372_100857634 | 3300010360 | Tropical Forest Soil | FGADPAASTADLDLNAEERAAFVARDMRRINELGGYLHLVLSIPGLAVHAPRG* |
| Ga0126372_112207092 | 3300010360 | Tropical Forest Soil | ADARGVLEGLDLTEEERAAFLARDMTRINALGGYLHLVMSVPGLAIHITHPERD* |
| Ga0137391_109306561 | 3300011270 | Vadose Zone Soil | LAGADLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0137456_11257092 | 3300011428 | Soil | DLTDAERAAFVARDMRKINELGGYLHLVMSVPGLAAH* |
| Ga0137338_11310722 | 3300012174 | Soil | DLSDEERRAFVARDARRINELGGYLHLVMSVPGIAGH* |
| Ga0137388_113642392 | 3300012189 | Vadose Zone Soil | EPEAALADVDLSDDERRAFVARDARRINELGGYLHLVMSVPGIAGH* |
| Ga0137383_101404931 | 3300012199 | Vadose Zone Soil | ALAGADLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0137363_117306931 | 3300012202 | Vadose Zone Soil | AGTALAGADLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH* |
| Ga0137399_102662761 | 3300012203 | Vadose Zone Soil | PAAALAGLDLTEPERSAFVARDMRKINELGGYLHLVMSIPGLAAH* |
| Ga0137379_114136171 | 3300012209 | Vadose Zone Soil | PAAALAGLDLTEPERSAFIARDMRKINELGGYLHLVMSVPGLAAH* |
| Ga0137371_112021131 | 3300012356 | Vadose Zone Soil | ALDGLDLTDAERAAFLARDMRRINALGGYLHLVMSVPGMAAHVTHAEPE* |
| Ga0157290_100835122 | 3300012909 | Soil | RAALADADLTEAEREAFVAHDMRRINELGGYLHLVMSIPGLAAH* |
| Ga0137396_113003432 | 3300012918 | Vadose Zone Soil | LTAAERAAFEERDMRKINELGGYLHLVMSVPGLAAH* |
| Ga0137394_1000434414 | 3300012922 | Vadose Zone Soil | RSAFVARDMRRINELGGYLHLVMSIPGLAASQRATT* |
| Ga0137416_100994021 | 3300012927 | Vadose Zone Soil | ALAGLDLTDAERAAFEARDMRKINELGGYLHLVMSVPGLAAH* |
| Ga0137404_110631102 | 3300012929 | Vadose Zone Soil | RAAFLARDMERINALGGYLHLVMSVPGMAAHVTHTEPE* |
| Ga0153916_131738011 | 3300012964 | Freshwater Wetlands | NEVADLTDAERAAFIARDMRRINGLRGYLHLVMSVPDLAAH* |
| Ga0134110_101417861 | 3300012975 | Grasslands Soil | LSADERAAFAARDMRRINELGGYLHLVLSIPGLAVHPPRR* |
| Ga0137409_114098081 | 3300015245 | Vadose Zone Soil | REPEAALADVDLSDDERRAFIARDARRINELGGYLHLVMSVPGIAGH* |
| Ga0137403_110509232 | 3300015264 | Vadose Zone Soil | GADLTEAERAAFVRRDMRALNELGGYLHLVLSIPGMAAH* |
| Ga0134085_105200821 | 3300015359 | Grasslands Soil | PEAALAGADLTEAERAAFIARDMRKVNELGGYLHLVMSIPGLAAH* |
| Ga0132258_115207171 | 3300015371 | Arabidopsis Rhizosphere | ADARAALAGLDLSEAERAAFVARDVRRINELGGYLHLVMSVPGLAAH* |
| Ga0132255_1031330241 | 3300015374 | Arabidopsis Rhizosphere | TRTIADLDLTDPERAAFIARDLRKINELGGYLHLVMSVPGLAVH* |
| Ga0134112_101021501 | 3300017656 | Grasslands Soil | TRDPGTAVADADLTDAERSAFVARDMRKINELGGYLHLVMSIPGLAASHRATT |
| Ga0134083_105726502 | 3300017659 | Grasslands Soil | GLDLTDAERAAFLARDMQRINALGGYLHLVMSVPGMAAHVTHPEPE |
| Ga0184608_100956031 | 3300018028 | Groundwater Sediment | TEAERAAFVARDMRAINELGGYLHLVMSIPGLAAH |
| Ga0184634_105205321 | 3300018031 | Groundwater Sediment | FEADARAALAGLDLTDAERAAFVARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0190272_120563382 | 3300018429 | Soil | LAGLDLTDAERAAFEARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0193723_11533262 | 3300019879 | Soil | AGLDLTDAEQAAFEARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0193730_10103621 | 3300020002 | Soil | ADAAASLAGLDLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0193755_12015421 | 3300020004 | Soil | SVLAGLDLTEAERAAFIARDMRRINELGGYLHLVMSVPGLAAH |
| Ga0194131_101043211 | 3300020193 | Freshwater Lake | LAGADLTDTERAAFVAHDMRKINELGGYLHLVMSIPGLAAH |
| Ga0194120_101512951 | 3300020198 | Freshwater Lake | DLTDTERAAFVAHDMRKINELGGYLHLVMSIPGLAAH |
| Ga0193695_11135321 | 3300021418 | Soil | AGLDLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0210073_10193871 | 3300025569 | Natural And Restored Wetlands | LDLTDAERAAFVARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0207647_102978541 | 3300025904 | Corn Rhizosphere | SALADLDLTEDERAAFIARDMRRINELGGYLHLVMSVPGLAAH |
| Ga0207709_112352691 | 3300025935 | Miscanthus Rhizosphere | PAQAIADLDLSEVERAAFVERDRRRINELGGYLHLVMSIPGLARH |
| Ga0207668_106729481 | 3300025972 | Switchgrass Rhizosphere | ARFVANGADALADLDLSNEERAAFLAHDMRKINELGGYLHLVMSIPGLAGH |
| Ga0209055_10115001 | 3300026309 | Soil | LAGLDLTEPERSAFIARDMRKINELGGYLHLVMSIPGLAAH |
| Ga0209152_101256892 | 3300026325 | Soil | GERAAFRARDMERINALGGYLHLVMSVPGMAAHVTHTEPE |
| Ga0209802_12626302 | 3300026328 | Soil | EADAGTALAGADLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0209803_12545162 | 3300026332 | Soil | AAALAGADLTADERAAFVARDMRRINELGGYLHLVMSIPGLAAH |
| Ga0257173_10079773 | 3300026360 | Soil | QADAAAALAGLDLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0257171_10399682 | 3300026377 | Soil | RAALVGLDLTDAERAAFVARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0209690_12091821 | 3300026524 | Soil | SAFVARDMRRINELGGYLHLVMSIPGLAASQRATT |
| Ga0209157_10384713 | 3300026537 | Soil | DLTEAERAAFIARDMRKVNELGGYLHLVMSIPGLAAH |
| Ga0209156_101346552 | 3300026547 | Soil | DAERAAFLARDMQRINALGGYLHLVMSVPGMAAHVTHPEP |
| Ga0256865_10901932 | 3300027657 | Soil | DPAAAVAGLDLTDAERAAFIARDMKRINALGGYLHLVMSVPGLAAHVTHPEREA |
| Ga0209726_100969464 | 3300027815 | Groundwater | LIGLDLTDAERAAFVARDMRKINELGGYLHLVMSVPGLAAH |
| Ga0209481_103525542 | 3300027880 | Populus Rhizosphere | VVHADLTEAERAAFVARDMRRINELGGYLHLVMSIPGLAAH |
| Ga0247828_102708161 | 3300028587 | Soil | VDLTEAERAAFVNHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0247818_111588561 | 3300028589 | Soil | DPGPAIATADLSDAERAAFVARDMRRINELGGYLHLVMSIPGLAAH |
| Ga0247820_105222892 | 3300028597 | Soil | EALADLDLSNEERAAFLAHDMRKINELGGYLHLVMSIPGLAGH |
| Ga0307504_104197261 | 3300028792 | Soil | YLADTTGSIVELDLTDAERAAFVARDMRRINELGGYLHLVMSVPGLAAH |
| Ga0307312_104133231 | 3300028828 | Soil | GLDLTEAERAAFIARDMRRINELGGYLHLVMSVPGLAAH |
| Ga0299907_104283211 | 3300030006 | Soil | EDAAGALAEADLTDAERAAFVARDMRQINELGGYLHLVMSIPGLAGH |
| Ga0310888_108038481 | 3300031538 | Soil | ADADLTEAERAAFAAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0307469_106867641 | 3300031720 | Hardwood Forest Soil | EPEAALANVDLTEDERRAFVARDARRINELGGYLHLVMSVPGIAGH |
| Ga0307473_115522222 | 3300031820 | Hardwood Forest Soil | LTGIDLTEAERAAFVAHDMRRINELGGYLHLVMSVPGLAAH |
| Ga0214473_107280543 | 3300031949 | Soil | RAAFIARDMTRINALGGYLHLVMSVPGLAAHVTHAERAD |
| Ga0335079_117119232 | 3300032783 | Soil | AFLARDMTRINALGGYLHLVMSVPGLAVHITHPERE |
| Ga0335083_104892321 | 3300032954 | Soil | DEERAAFLARDMTRINALGGYLHLVMSVPGLAVHITHPERE |
| Ga0316628_1037190721 | 3300033513 | Soil | ADADLTEAERAAFATRDVRRINELGGYLHLVMSVPGLAAH |
| ⦗Top⦘ |