


| Basic Information | |
|---|---|
| Family ID | F095261 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKRQLVTAAALFALAATAVGAVQVTAQDSRVVCIPPAVIQALS |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.24 % |
| % of genes near scaffold ends (potentially truncated) | 17.14 % |
| % of genes from short scaffolds (< 2000 bps) | 79.05 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.905 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13417 | GST_N_3 | 26.67 |
| PF00126 | HTH_1 | 24.76 |
| PF02798 | GST_N | 19.05 |
| PF03466 | LysR_substrate | 14.29 |
| PF02900 | LigB | 5.71 |
| PF01769 | MgtE | 0.95 |
| PF02253 | PLA1 | 0.95 |
| PF01264 | Chorismate_synt | 0.95 |
| PF04909 | Amidohydro_2 | 0.95 |
| PF13343 | SBP_bac_6 | 0.95 |
| PF00571 | CBS | 0.95 |
| PF13409 | GST_N_2 | 0.95 |
| PF00393 | 6PGD | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.95 |
| COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2829 | Outer membrane phospholipase A | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.24 % |
| Unclassified | root | N/A | 24.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002906|JGI25614J43888_10000388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12106 | Open in IMG/M |
| 3300002907|JGI25613J43889_10000832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 7537 | Open in IMG/M |
| 3300002908|JGI25382J43887_10461062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300003321|soilH1_10058768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300004463|Ga0063356_103904327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
| 3300004803|Ga0058862_12628273 | Not Available | 839 | Open in IMG/M |
| 3300005172|Ga0066683_10299778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 999 | Open in IMG/M |
| 3300005175|Ga0066673_10745652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300005175|Ga0066673_10809868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
| 3300005176|Ga0066679_10356245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
| 3300005178|Ga0066688_10080422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1955 | Open in IMG/M |
| 3300005187|Ga0066675_11045813 | Not Available | 612 | Open in IMG/M |
| 3300005330|Ga0070690_101386913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300005436|Ga0070713_101864648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300005447|Ga0066689_10113070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1574 | Open in IMG/M |
| 3300005454|Ga0066687_10106254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1425 | Open in IMG/M |
| 3300005471|Ga0070698_100174116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2092 | Open in IMG/M |
| 3300005518|Ga0070699_100022699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 5408 | Open in IMG/M |
| 3300005518|Ga0070699_100768851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300005540|Ga0066697_10043770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2522 | Open in IMG/M |
| 3300005545|Ga0070695_101821459 | Not Available | 511 | Open in IMG/M |
| 3300005556|Ga0066707_10194739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1306 | Open in IMG/M |
| 3300005560|Ga0066670_11045991 | Not Available | 500 | Open in IMG/M |
| 3300005561|Ga0066699_10117660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1776 | Open in IMG/M |
| 3300005566|Ga0066693_10067607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1232 | Open in IMG/M |
| 3300005615|Ga0070702_101100372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 635 | Open in IMG/M |
| 3300005985|Ga0081539_10000443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 88031 | Open in IMG/M |
| 3300006031|Ga0066651_10595609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 588 | Open in IMG/M |
| 3300006032|Ga0066696_10355084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300006032|Ga0066696_10443115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
| 3300006791|Ga0066653_10482924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 628 | Open in IMG/M |
| 3300006800|Ga0066660_11676552 | Not Available | 506 | Open in IMG/M |
| 3300006806|Ga0079220_11319571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300006854|Ga0075425_100526219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1361 | Open in IMG/M |
| 3300006854|Ga0075425_100601298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1265 | Open in IMG/M |
| 3300006854|Ga0075425_101429700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 782 | Open in IMG/M |
| 3300006871|Ga0075434_101332224 | Not Available | 728 | Open in IMG/M |
| 3300006903|Ga0075426_10000756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 22500 | Open in IMG/M |
| 3300006904|Ga0075424_100378276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1509 | Open in IMG/M |
| 3300006914|Ga0075436_101311674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300009012|Ga0066710_100696959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1548 | Open in IMG/M |
| 3300009089|Ga0099828_11082464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300009137|Ga0066709_102666738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300009143|Ga0099792_10024732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2721 | Open in IMG/M |
| 3300010337|Ga0134062_10402624 | Not Available | 670 | Open in IMG/M |
| 3300010396|Ga0134126_13002512 | Not Available | 510 | Open in IMG/M |
| 3300010403|Ga0134123_11538968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300011270|Ga0137391_10721537 | Not Available | 827 | Open in IMG/M |
| 3300012206|Ga0137380_10704254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300012212|Ga0150985_104038449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300012212|Ga0150985_115613571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 578 | Open in IMG/M |
| 3300012212|Ga0150985_118169282 | Not Available | 559 | Open in IMG/M |
| 3300012212|Ga0150985_118723807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 592 | Open in IMG/M |
| 3300012363|Ga0137390_10313315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1551 | Open in IMG/M |
| 3300012469|Ga0150984_108446940 | Not Available | 516 | Open in IMG/M |
| 3300012685|Ga0137397_11281965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 522 | Open in IMG/M |
| 3300012922|Ga0137394_10541476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 987 | Open in IMG/M |
| 3300012923|Ga0137359_10035448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4300 | Open in IMG/M |
| 3300012929|Ga0137404_10000356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 29768 | Open in IMG/M |
| 3300012961|Ga0164302_10733949 | Not Available | 736 | Open in IMG/M |
| 3300015245|Ga0137409_10830468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300017654|Ga0134069_1343604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
| 3300017656|Ga0134112_10488157 | Not Available | 520 | Open in IMG/M |
| 3300018433|Ga0066667_11431450 | Not Available | 608 | Open in IMG/M |
| 3300018468|Ga0066662_11458279 | Not Available | 710 | Open in IMG/M |
| 3300018482|Ga0066669_10097583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2031 | Open in IMG/M |
| 3300018482|Ga0066669_10393294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1170 | Open in IMG/M |
| 3300018482|Ga0066669_12190418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300019789|Ga0137408_1079770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 4955 | Open in IMG/M |
| 3300020202|Ga0196964_10002112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9650 | Open in IMG/M |
| 3300024219|Ga0247665_1033928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300024284|Ga0247671_1082512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300024290|Ga0247667_1018811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300024347|Ga0179591_1044634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1725 | Open in IMG/M |
| 3300025898|Ga0207692_10677084 | Not Available | 668 | Open in IMG/M |
| 3300025905|Ga0207685_10513001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300025912|Ga0207707_11218401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300025939|Ga0207665_10222406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1384 | Open in IMG/M |
| 3300026304|Ga0209240_1010147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3571 | Open in IMG/M |
| 3300026305|Ga0209688_1024330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300026316|Ga0209155_1224350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300026318|Ga0209471_1135154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300026319|Ga0209647_1159646 | Not Available | 926 | Open in IMG/M |
| 3300026319|Ga0209647_1312445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300026320|Ga0209131_1011806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5404 | Open in IMG/M |
| 3300026327|Ga0209266_1292328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
| 3300026331|Ga0209267_1130690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300026527|Ga0209059_1062959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
| 3300026530|Ga0209807_1033121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2474 | Open in IMG/M |
| 3300026538|Ga0209056_10604743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300026548|Ga0209161_10405351 | Not Available | 599 | Open in IMG/M |
| 3300026550|Ga0209474_10596716 | Not Available | 564 | Open in IMG/M |
| 3300026550|Ga0209474_10609172 | Not Available | 559 | Open in IMG/M |
| 3300027748|Ga0209689_1025697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3568 | Open in IMG/M |
| 3300027903|Ga0209488_10015241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5598 | Open in IMG/M |
| 3300031481|Ga0314816_1027185 | Not Available | 725 | Open in IMG/M |
| 3300031548|Ga0307408_102347245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300031720|Ga0307469_11667532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 614 | Open in IMG/M |
| 3300032002|Ga0307416_101341315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300032770|Ga0335085_12392622 | Not Available | 526 | Open in IMG/M |
| 3300033412|Ga0310810_11006355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 711 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.90% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.95% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.95% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25614J43888_100003883 | 3300002906 | Grasslands Soil | MKRQLVTAAALLALAATALAGVHATTQEAHIVCIPPAVIQALS* |
| JGI25613J43889_100008329 | 3300002907 | Grasslands Soil | MKRQLVTAGALLALAATALAGVHATTQEAHIVCIPPAVIQALS* |
| JGI25382J43887_104610622 | 3300002908 | Grasslands Soil | MKRQLVTAAALLALAVTALGAVQVTAADSRVVCIPPAVIQALS* |
| soilH1_100587681 | 3300003321 | Sugarcane Root And Bulk Soil | MWLKKSLITGAAIAALGATALGAVQVTAPGAGVVCLPPAVVQAWS* |
| soilH1_100587693 | 3300003321 | Sugarcane Root And Bulk Soil | MLKRSVVTGVALAALVATGFAAVQVTAQGSRIVCLPPAVVQAWS* |
| Ga0055469_100138411 | 3300003999 | Natural And Restored Wetlands | MKRSLVTAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS* |
| Ga0063356_1039043272 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKPFVTAAALTLLAATAFGAVQVTNSPRVVCIPPAVVQAWS* |
| Ga0058862_126282732 | 3300004803 | Host-Associated | MMKRQLVTAAAITMLAAAAFGAVQLTAHDARVVCIPPAVVQAWS* |
| Ga0066683_102997782 | 3300005172 | Soil | MKRQLVTAAALLALAVTALGAVQVTATDSRVVCIPPAVIQALS* |
| Ga0066673_107456522 | 3300005175 | Soil | MRRTLVTAAALASLVATAAGAVQVTASQARLVCLPPAVIQAWS* |
| Ga0066673_108098682 | 3300005175 | Soil | MKRQLVTAAALIALAATAFAGVHVTSQESHLVCIPPAVIHALS* |
| Ga0066679_103562452 | 3300005176 | Soil | MKRQLVTAAALLALALTALGAVQVTATDSRVVCIPPAVIQALS* |
| Ga0066688_100804223 | 3300005178 | Soil | MKRKLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS* |
| Ga0066675_110458131 | 3300005187 | Soil | KRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS* |
| Ga0070690_1013869132 | 3300005330 | Switchgrass Rhizosphere | MKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0070713_1018646482 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRQLVTVAALIALAATMLGAVQITDTERRAVCIPPAVVQAWS* |
| Ga0066689_101130702 | 3300005447 | Soil | MKRQLVTVAALLALAVTALGAVQVTAPDSRVVCIPPAVIQALS* |
| Ga0066687_101062543 | 3300005454 | Soil | MKRQLVTAAALIALAATALGAVHVTDTERSAVCIPPAVVQAWS* |
| Ga0070698_1001741161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHLITAAAFMLLAATAFGAVHVTDSSRVVCIPPAVVQAWS* |
| Ga0070699_1000226995 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRTLVTAAALVALAATALGAVHVTAPDGRSVCLPAPVIQAWS* |
| Ga0070699_1007688512 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKHLITAAALMLLAATAFGAVHVTDSSRVVCIPPAVVQAWS* |
| Ga0066697_100437703 | 3300005540 | Soil | MKRKLVTAAALIALAATAFAGVHATSQESHLVCIAPAVIHALS* |
| Ga0070695_1018214592 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRQLVTVAALIALAATALGAVRVTDTARSAVCIPPAVVQAWS* |
| Ga0066707_101947392 | 3300005556 | Soil | MKRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS* |
| Ga0066670_110459911 | 3300005560 | Soil | MRRTLVTAAALASLVATAAGAVRVTASQARLVCLPPAVIQAWS* |
| Ga0066699_101176603 | 3300005561 | Soil | MKRQLVTAAALIALAATAFAGIHATSQEPHIVCIPPAVIQALS* |
| Ga0066693_100676073 | 3300005566 | Soil | MKQILVSAAALLALAATAAGAVQITAQNARLVCLPPAVIQAWS* |
| Ga0070702_1011003721 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRQLVTVAALFALAATALGAVHVTAQERATVCIPPAVVQAWS* |
| Ga0081539_1000044387 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MQRTLVTAAALLLLAVTGAGAVQLTALNAQVVCLPPAVIQAWS* |
| Ga0066651_105956091 | 3300006031 | Soil | MKRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS* |
| Ga0066696_103550843 | 3300006032 | Soil | RQLGSPMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0066696_104431152 | 3300006032 | Soil | MKRQLVTAAALLALAVTAVGAVQVTTTDSRVVCLPPAVIHALS* |
| Ga0066653_104829241 | 3300006791 | Soil | MKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0066660_116765523 | 3300006800 | Soil | MRRTLVTATALASLVATAAGAVRVTASQARLVCLPPAVIQAWS* |
| Ga0079220_113195712 | 3300006806 | Agricultural Soil | MWLKKSLITGAAVAALGATALGAVQVTAPGARVVCLPPAVIQAWS* |
| Ga0075425_1005262192 | 3300006854 | Populus Rhizosphere | MKRQLITVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0075425_1006012981 | 3300006854 | Populus Rhizosphere | MRRVLVTVGALAALAATAAGAVHVTAPEARVVCLPPAVVQAWS* |
| Ga0075425_1014297001 | 3300006854 | Populus Rhizosphere | MRRTLVTAAALVTLAATALGAVQVTAPEARTVCLPAAVIQAWS* |
| Ga0075434_1013322242 | 3300006871 | Populus Rhizosphere | GSPMKRQLVTVAALIALAATALGAVRVTDTERSAICIPPAVVQAWS* |
| Ga0075426_1000075623 | 3300006903 | Populus Rhizosphere | LVTAAALVTLAATALGAVQVTAPEARTVCLPAAVIQAWS* |
| Ga0075424_1003782762 | 3300006904 | Populus Rhizosphere | LRQLGSPMKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0075436_1013116742 | 3300006914 | Populus Rhizosphere | MKRQLVTVAALIALAATALGAVQVTDTERSAVCIPPAVVQAWS* |
| Ga0066710_1006969592 | 3300009012 | Grasslands Soil | MKRQLVTAAALLALAVTAVGAVQVTTTDSRVVCLPPAVIQALS |
| Ga0099828_110824642 | 3300009089 | Vadose Zone Soil | MKKQLVTAAALLALAVTAVGAVQVTAPDSHVVCIPPAVIPAVIQVLS* |
| Ga0066709_1026667382 | 3300009137 | Grasslands Soil | MKRQLVTAAALIALAATALGAVHVTAQERSTVCIPPAVIKALS* |
| Ga0099792_100247323 | 3300009143 | Vadose Zone Soil | MKRQLVTAGALLALAATALAGVHATTQEPHIVCIPPAVILALS* |
| Ga0134062_104026242 | 3300010337 | Grasslands Soil | ARNLRQIGSPMKRQLVTVAALIAMAATALGAVHVTEQERSTVCIPPAVIQALS* |
| Ga0134126_130025122 | 3300010396 | Terrestrial Soil | QTFAMKRFLVTGAVLAALAVVSISAVQVTTQESRAVCIPPAVVQAWS* |
| Ga0134123_115389682 | 3300010403 | Terrestrial Soil | MKRQLVTAAALIALAATALGAVHVTAQERATVCIPPAVIQALT* |
| Ga0137391_107215372 | 3300011270 | Vadose Zone Soil | MRKQHVTALALAALAAATLGAVQITAQDSHMVCIPPAVIQALS* |
| Ga0137380_107042542 | 3300012206 | Vadose Zone Soil | MKRQLVTAAALFALAATAVGAVQVTAQDSRVVCIPPAVIQALS* |
| Ga0150985_1040384491 | 3300012212 | Avena Fatua Rhizosphere | MRRTLVTAAALALLGATAAGAVQVTASDARLVCLPPAVIQAWS* |
| Ga0150985_1156135711 | 3300012212 | Avena Fatua Rhizosphere | IGSSMKRQLVTAAALFALAATALGAVHVTAQERATVCIPPAVVQAWS* |
| Ga0150985_1181692822 | 3300012212 | Avena Fatua Rhizosphere | MKRQLVTLAALFALAATALGAVHVTAQERASVCIPPAVVQAWS* |
| Ga0150985_1187238072 | 3300012212 | Avena Fatua Rhizosphere | MKRQLVTVAALIALTATGLGAVHVTEQERSTVCIPPAVIQALS* |
| Ga0137390_103133152 | 3300012363 | Vadose Zone Soil | MRKQLVTALALAALAAATLGAVQITAQDSHMVCIPPAVIQALS* |
| Ga0150984_1084469402 | 3300012469 | Avena Fatua Rhizosphere | FRSRGLRMKRTLVTAAALALFGATAAGAVQVTASDARLVCLPPAVIQAWS* |
| Ga0137397_112819652 | 3300012685 | Vadose Zone Soil | MKRQLITVAALIALAATALGAVHVTDTERRAVCIPPAVIQAWS* |
| Ga0137394_105414763 | 3300012922 | Vadose Zone Soil | MRRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS* |
| Ga0137359_100354486 | 3300012923 | Vadose Zone Soil | MKRQLITAGALLALAATALAGVHATTQEAHIVCIPPGVIQALS* |
| Ga0137404_1000035623 | 3300012929 | Vadose Zone Soil | MKRQLVTVAALVALAATALGAVRVTAQERATVCIPPAVIQALS* |
| Ga0164302_107339492 | 3300012961 | Soil | AALIALAATALGAVRVTDTERSAVCIPPAVVQAWS* |
| Ga0075316_12217721 | 3300014314 | Natural And Restored Wetlands | TAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS* |
| Ga0137409_108304682 | 3300015245 | Vadose Zone Soil | MQLAAGETSMKRQLVTAAALLALAATALAGVHATTQEPHIVCIPPAVIQALS* |
| Ga0134069_13436041 | 3300017654 | Grasslands Soil | MKRQLVTAAALFALAVTAVGAVQVTAQDARVVCIPPA |
| Ga0134112_104881571 | 3300017656 | Grasslands Soil | MKRQLVTAAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS |
| Ga0066667_114314501 | 3300018433 | Grasslands Soil | TLVTAAALASLVATAAGAVQVTASDARLVCLPPAVIQAWS |
| Ga0066662_114582792 | 3300018468 | Grasslands Soil | MKRTIVTAAALALLGATAAGAVQVTASEARLLCLPPAVIQAWS |
| Ga0066669_100975832 | 3300018482 | Grasslands Soil | MRRTLVTAAALASIVATAAGAVRVTASQARLVCLPPAVIQAWS |
| Ga0066669_103932942 | 3300018482 | Grasslands Soil | MKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS |
| Ga0066669_121904181 | 3300018482 | Grasslands Soil | MKRQLVTAAALLALAVTALGAVQVTATDSHVVCIPPAVIQAL |
| Ga0137408_10797705 | 3300019789 | Vadose Zone Soil | MKRQLVTVAALVALAATALGAVRVTAQERATVCIPPAVIQALS |
| Ga0196964_100021127 | 3300020202 | Soil | MKKGFITAVALAALAATAVGAVQVTTPDSVVRLPAAVIQALS |
| Ga0247665_10339282 | 3300024219 | Soil | MKRQLVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS |
| Ga0247671_10825122 | 3300024284 | Soil | MKRQLVTVAALIALAATALGAVQVTDTERSTVCIPPAVVQAWS |
| Ga0247667_10188111 | 3300024290 | Soil | LRQIGSPMKRQLVTVAALFALAATALGAVQVTDTERSTVCIPPAVVQAWS |
| Ga0179591_10446343 | 3300024347 | Vadose Zone Soil | MRRQLVTVAALIAMAATALGAVHVTEQERSTVCIPPAVIQALS |
| Ga0210114_10179714 | 3300025795 | Natural And Restored Wetlands | MKRSLVTAAALLALVAAAFGAVQMTAQGSRLVCIPAAVVQAWS |
| Ga0207692_106770841 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KRQLVTVAALIALAATMLGAVQITDTERRAVCIPPAVVQAWS |
| Ga0207685_105130012 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TCDRKSTHMKRTLVTAVALVALTATAFGAVQVTDQEGRAVCVPPAVIQALS |
| Ga0207707_112184012 | 3300025912 | Corn Rhizosphere | MMKRQLVTAAAITMLAAAAFGAVQLTAHDARVVCIPPAVVQAWS |
| Ga0207665_102224064 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRQLITVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS |
| Ga0209240_10101475 | 3300026304 | Grasslands Soil | MKRQLVTAAALLALAATALAGVHATTQEAHIVCIPPAVIQALS |
| Ga0209688_10243303 | 3300026305 | Soil | MKQILVSAAALLALAATAAGAVQITAQNARLVCLPPAVIQAWS |
| Ga0209155_12243502 | 3300026316 | Soil | MKRQLVTAAALIALAATAFAGVHVTSQESHLVCIPPAVIHALS |
| Ga0209471_11351542 | 3300026318 | Soil | MKRQLVTAAALLALALTALGAVQVTATDSRVVCIPPAVIQALS |
| Ga0209647_11596462 | 3300026319 | Grasslands Soil | MRRQLVTVAALIALAATALGAVHVTEQERSTVCIPPAVIQALS |
| Ga0209647_13124451 | 3300026319 | Grasslands Soil | MQLAAGETSMKRQLVTAGALLALAATALAGVHATTQEPHIVCIPPAVIQALS |
| Ga0209131_10118068 | 3300026320 | Grasslands Soil | MKRQLVTAGALLALAATALAGVHATTQEPHIVCIPLAVIQALS |
| Ga0209266_12923282 | 3300026327 | Soil | MKRQLVTAAALLALAVTALGAVQVTATDSRVVCIPPAVIQALS |
| Ga0209267_11306902 | 3300026331 | Soil | MKRKLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS |
| Ga0209059_10629593 | 3300026527 | Soil | MRRTLVTAAALASLVATAAGAVRVTASQARLVCLPPAVIQAWS |
| Ga0209807_10331212 | 3300026530 | Soil | MKRKLVTAAALIALAATAFAGVHATSQESHLVCIAPAVIHALS |
| Ga0209056_106047432 | 3300026538 | Soil | MKRQLVTVAALLALAVTALGAVQVTAPDSRVVCIPPAVIQALS |
| Ga0209161_104053512 | 3300026548 | Soil | MQLAAGESSMKRQLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS |
| Ga0209474_105967162 | 3300026550 | Soil | KRQLVTAAALIALAATAFAGVHATSQESHLVCIPPAVIHALS |
| Ga0209474_106091722 | 3300026550 | Soil | RNLRQLGSPMKRELVTVAALIALAATALGAVRVTDTERSAVCIPPAVVQAWS |
| Ga0209689_10256971 | 3300027748 | Soil | MKRQLVTVAALLALAVTALGAVQVTAPDSRVVCLPPAVIQALS |
| Ga0209488_100152413 | 3300027903 | Vadose Zone Soil | MKRQLVTAAALLALAATALAGVHATTQEPHIVCIPPAVILALS |
| Ga0314816_10271851 | 3300031481 | Soil | MKRQLITAAALTALVAAAFGAVQVTAQDARTVCIPPAVVQAWS |
| Ga0307408_1023472452 | 3300031548 | Rhizosphere | MKKGLITAVALLALAVTAVGAVQVTTPGSVVEIPAAVIQAWS |
| Ga0307469_116675322 | 3300031720 | Hardwood Forest Soil | MKRQLVTVAALIALAATALGAVHVTESERSAVCIPPAVIQAWS |
| Ga0307416_1013413152 | 3300032002 | Rhizosphere | MKKGLITVVALLALAATAVGAVQVTTPGCVVEIPVAVIQAWS |
| Ga0335085_123926221 | 3300032770 | Soil | MKRQLVTVAALIALAATALGAVHVTSEERSALCIPPAVIQAWS |
| Ga0310810_110063552 | 3300033412 | Soil | MKRQWVTAAAIAMLAATAFGAVQVTAQDARVVCIPPAVVQAWS |
| ⦗Top⦘ |