


| Basic Information | |
|---|---|
| Family ID | F095253 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EPGALRAALAASVLALMREGAEARLPHADVVAQRLAELR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 92.38 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 1.90 |
| PF04248 | NTP_transf_9 | 1.90 |
| PF13847 | Methyltransf_31 | 1.90 |
| PF04191 | PEMT | 1.90 |
| PF01135 | PCMT | 1.90 |
| PF08448 | PAS_4 | 1.90 |
| PF14219 | DUF4328 | 1.90 |
| PF00069 | Pkinase | 1.90 |
| PF02861 | Clp_N | 1.90 |
| PF07690 | MFS_1 | 1.90 |
| PF12867 | DinB_2 | 1.90 |
| PF00106 | adh_short | 0.95 |
| PF00582 | Usp | 0.95 |
| PF00196 | GerE | 0.95 |
| PF06224 | HTH_42 | 0.95 |
| PF01063 | Aminotran_4 | 0.95 |
| PF01668 | SmpB | 0.95 |
| PF00353 | HemolysinCabind | 0.95 |
| PF01243 | Putative_PNPOx | 0.95 |
| PF07992 | Pyr_redox_2 | 0.95 |
| PF03459 | TOBE | 0.95 |
| PF05050 | Methyltransf_21 | 0.95 |
| PF00561 | Abhydrolase_1 | 0.95 |
| PF13174 | TPR_6 | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF01565 | FAD_binding_4 | 0.95 |
| PF01850 | PIN | 0.95 |
| PF00067 | p450 | 0.95 |
| PF01061 | ABC2_membrane | 0.95 |
| PF13460 | NAD_binding_10 | 0.95 |
| PF01594 | AI-2E_transport | 0.95 |
| PF10792 | DUF2605 | 0.95 |
| PF14534 | DUF4440 | 0.95 |
| PF14329 | DUF4386 | 0.95 |
| PF13450 | NAD_binding_8 | 0.95 |
| PF11139 | SfLAP | 0.95 |
| PF05343 | Peptidase_M42 | 0.95 |
| PF02678 | Pirin | 0.95 |
| PF02518 | HATPase_c | 0.95 |
| PF01872 | RibD_C | 0.95 |
| PF01625 | PMSR | 0.95 |
| PF01548 | DEDD_Tnp_IS110 | 0.95 |
| PF08240 | ADH_N | 0.95 |
| PF01266 | DAO | 0.95 |
| PF12710 | HAD | 0.95 |
| PF10604 | Polyketide_cyc2 | 0.95 |
| PF03734 | YkuD | 0.95 |
| PF00584 | SecE | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.62 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.90 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.90 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 1.90 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.95 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.95 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.95 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG1362 | Aspartyl aminopeptidase | Amino acid transport and metabolism [E] | 0.95 |
| COG1363 | Putative aminopeptidase FrvX | Carbohydrate transport and metabolism [G] | 0.95 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.95 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.95 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.95 |
| COG2195 | Di- or tripeptidase | Amino acid transport and metabolism [E] | 0.95 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.95 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.86 % |
| Unclassified | root | N/A | 37.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0683545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300000956|JGI10216J12902_102215027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_67_10 | 746 | Open in IMG/M |
| 3300000956|JGI10216J12902_116610764 | Not Available | 524 | Open in IMG/M |
| 3300002568|C688J35102_118857948 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004463|Ga0063356_106266657 | Not Available | 510 | Open in IMG/M |
| 3300004643|Ga0062591_101321589 | Not Available | 710 | Open in IMG/M |
| 3300005177|Ga0066690_10713853 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005178|Ga0066688_10235421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1170 | Open in IMG/M |
| 3300005181|Ga0066678_10147936 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300005338|Ga0068868_100356647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
| 3300005436|Ga0070713_101447980 | Not Available | 666 | Open in IMG/M |
| 3300005447|Ga0066689_10420245 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005450|Ga0066682_10321200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
| 3300005518|Ga0070699_101481960 | Not Available | 622 | Open in IMG/M |
| 3300005540|Ga0066697_10652579 | Not Available | 579 | Open in IMG/M |
| 3300005557|Ga0066704_10560892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300005559|Ga0066700_10268141 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005559|Ga0066700_10697275 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005576|Ga0066708_10610693 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005598|Ga0066706_10333314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1200 | Open in IMG/M |
| 3300005598|Ga0066706_10602443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300005981|Ga0081538_10000143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 73830 | Open in IMG/M |
| 3300006791|Ga0066653_10750117 | Not Available | 509 | Open in IMG/M |
| 3300006845|Ga0075421_102516137 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006854|Ga0075425_100764417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
| 3300006871|Ga0075434_101755528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 628 | Open in IMG/M |
| 3300006904|Ga0075424_101859467 | Not Available | 636 | Open in IMG/M |
| 3300007076|Ga0075435_100100699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2394 | Open in IMG/M |
| 3300009012|Ga0066710_100169659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3066 | Open in IMG/M |
| 3300009012|Ga0066710_102447882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300009012|Ga0066710_103533870 | Not Available | 591 | Open in IMG/M |
| 3300009012|Ga0066710_104238928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300009089|Ga0099828_11726165 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009090|Ga0099827_10935229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Panacagrimonas → Panacagrimonas perspica | 751 | Open in IMG/M |
| 3300009137|Ga0066709_100667155 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300009176|Ga0105242_11400943 | Not Available | 726 | Open in IMG/M |
| 3300010037|Ga0126304_10140222 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300010322|Ga0134084_10311894 | Not Available | 588 | Open in IMG/M |
| 3300010323|Ga0134086_10409347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300010371|Ga0134125_12832071 | Not Available | 527 | Open in IMG/M |
| 3300012186|Ga0136620_10404613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300012201|Ga0137365_10193707 | Not Available | 1521 | Open in IMG/M |
| 3300012204|Ga0137374_10581686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 856 | Open in IMG/M |
| 3300012207|Ga0137381_11032545 | Not Available | 708 | Open in IMG/M |
| 3300012208|Ga0137376_11779723 | Not Available | 507 | Open in IMG/M |
| 3300012209|Ga0137379_10379684 | Not Available | 1322 | Open in IMG/M |
| 3300012209|Ga0137379_11301237 | Not Available | 632 | Open in IMG/M |
| 3300012210|Ga0137378_11214603 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012211|Ga0137377_10675349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 968 | Open in IMG/M |
| 3300012351|Ga0137386_11103112 | Not Available | 560 | Open in IMG/M |
| 3300012532|Ga0137373_10583646 | Not Available | 844 | Open in IMG/M |
| 3300012957|Ga0164303_11295020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012986|Ga0164304_10107869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1675 | Open in IMG/M |
| 3300013297|Ga0157378_10972112 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300013770|Ga0120123_1176785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300013772|Ga0120158_10147052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
| 3300014487|Ga0182000_10160937 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300015201|Ga0173478_10763022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300015373|Ga0132257_101443503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 877 | Open in IMG/M |
| 3300015373|Ga0132257_101683787 | Not Available | 813 | Open in IMG/M |
| 3300015373|Ga0132257_103186380 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017654|Ga0134069_1328467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300017965|Ga0190266_10394064 | Not Available | 765 | Open in IMG/M |
| 3300017965|Ga0190266_10529488 | Not Available | 694 | Open in IMG/M |
| 3300018027|Ga0184605_10186664 | Not Available | 939 | Open in IMG/M |
| 3300018051|Ga0184620_10228940 | Not Available | 622 | Open in IMG/M |
| 3300018054|Ga0184621_10118058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 947 | Open in IMG/M |
| 3300018054|Ga0184621_10296880 | Not Available | 570 | Open in IMG/M |
| 3300018071|Ga0184618_10181606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
| 3300018081|Ga0184625_10195183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1061 | Open in IMG/M |
| 3300018422|Ga0190265_13048098 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300018431|Ga0066655_10279864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
| 3300019356|Ga0173481_10409883 | Not Available | 666 | Open in IMG/M |
| 3300021073|Ga0210378_10166208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300022694|Ga0222623_10324481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300025927|Ga0207687_11467698 | Not Available | 586 | Open in IMG/M |
| 3300025933|Ga0207706_10391658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300025944|Ga0207661_10925237 | Not Available | 803 | Open in IMG/M |
| 3300026089|Ga0207648_12243281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. GAS493 | 507 | Open in IMG/M |
| 3300026530|Ga0209807_1313942 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026650|Ga0208217_100095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
| 3300027490|Ga0209899_1009698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2199 | Open in IMG/M |
| 3300027748|Ga0209689_1159564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300028708|Ga0307295_10191860 | Not Available | 577 | Open in IMG/M |
| 3300028715|Ga0307313_10102160 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300028722|Ga0307319_10115203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300028755|Ga0307316_10098669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300028784|Ga0307282_10194329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 969 | Open in IMG/M |
| 3300028784|Ga0307282_10574575 | Not Available | 547 | Open in IMG/M |
| 3300028796|Ga0307287_10352238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028799|Ga0307284_10024720 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300028811|Ga0307292_10068306 | Not Available | 1356 | Open in IMG/M |
| 3300028814|Ga0307302_10291671 | Not Available | 801 | Open in IMG/M |
| 3300028814|Ga0307302_10300283 | Not Available | 790 | Open in IMG/M |
| 3300028824|Ga0307310_10015191 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300028884|Ga0307308_10358382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300028884|Ga0307308_10546447 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028885|Ga0307304_10335680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300030514|Ga0268253_10035331 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300032075|Ga0310890_11218111 | Not Available | 613 | Open in IMG/M |
| 3300032159|Ga0268251_10184483 | Not Available | 808 | Open in IMG/M |
| 3300032174|Ga0307470_11410537 | Not Available | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.86% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026650 | Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_06835451 | 2228664021 | Soil | ETHVGSLEPAALRAALAAAVVALTSEGAKAGLPNAQIVADRLAELG |
| JGI10216J12902_1022150271 | 3300000956 | Soil | HAGSVDPGALRAALAASVRALLHEGAEADLAHAGVVAERLSSLAR* |
| JGI10216J12902_1166107642 | 3300000956 | Soil | ALRAALAASVSALMREGADADLITAKVVAERLADLH* |
| C688J35102_1188579482 | 3300002568 | Soil | AAVEPDALREALAASVLALVDQGAEAGLPDVDVVAERLAEFR* |
| Ga0063356_1062666571 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DAHVGAVEPAALRTALAASTRTLLWEGAEAHLPHADVVAQRLAELH* |
| Ga0062591_1013215891 | 3300004643 | Soil | GLEPEALRAALAASVVALLHEGEEARLPQAATVAERLADLR* |
| Ga0066690_107138531 | 3300005177 | Soil | HVGAVEPGALRAALAASVLALMREGAEARLPHAHVVAERLGELH* |
| Ga0066688_102354213 | 3300005178 | Soil | HVGAVEPGALRAALAASVLALMRAGAEARLPQADTVTQRLAELR* |
| Ga0066678_101479361 | 3300005181 | Soil | GAVEPGALRAALAASVLALIREGAEARLPHTDSVAQRLAELR* |
| Ga0068868_1003566474 | 3300005338 | Miscanthus Rhizosphere | AHVGALEPEALRAVLAASVVALTREGTEADIPHAQVVAERLAELR* |
| Ga0070713_1014479802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EPKELRAALAASVLGLVHEGAEAGLPHAHVVARRLAELH* |
| Ga0066689_104202451 | 3300005447 | Soil | HFDDAHVGAIEPEALRAALAASALALMREGAEARLSRADVVAERLADLR* |
| Ga0066682_103212003 | 3300005450 | Soil | EPGALRAALAASVLALMREGAEARLPHADVVAQRLAELR* |
| Ga0070699_1014819602 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | HVGAVEPGVLRAALAASVRALMREGAEARLPHAHIVAERLAELR* |
| Ga0066697_106525792 | 3300005540 | Soil | SLARLERAHLGAVEPDALRAALAASVIELMRQGEEARLAHAETVALRLAELR* |
| Ga0070695_1012531631 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AHIGALEPGALRTALAASAAALLHEGEEAHLPHARVVADRLAELQ* |
| Ga0066704_105608923 | 3300005557 | Soil | RAALAASVLALMRAGAEARLPQADTVTQRLAELR* |
| Ga0066700_102681411 | 3300005559 | Soil | AHVGALEPQPLRAALAASVLALMREGADARLSRADVVAERLADLR* |
| Ga0066700_103404081 | 3300005559 | Soil | ALRAALGASVLALMREGAEACLPHAKAVAQRLADLG* |
| Ga0066700_106972751 | 3300005559 | Soil | GALRAALAASVLALMREGAEARLPHADTVAQRLADRSSART* |
| Ga0066708_106106931 | 3300005576 | Soil | VGALEPQALRAALAASVLALLREGADARLPHADVVAERLADLR* |
| Ga0066706_103333141 | 3300005598 | Soil | ALRAALGASVLALMREGAEARLPHANAVAQRLAGLG* |
| Ga0066706_106024432 | 3300005598 | Soil | GALEPGALRAALAASALALIHEGAEARLPHAQVVAERLAELA* |
| Ga0081538_1000014321 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKPGSLRAALAASVSTLIHEGAEADLPTANIVAERITELC* |
| Ga0066653_107501171 | 3300006791 | Soil | LARFESSHVGAVDPDALRAALAGSVRGLIREGAEARLPNAATVAERLAELH* |
| Ga0075421_1025161372 | 3300006845 | Populus Rhizosphere | LRAALAASVRALLRAGSEARLPHADTVAQRLAELR* |
| Ga0075425_1007644172 | 3300006854 | Populus Rhizosphere | PDVLRAALAASVIELTRQGEEARLPHADTVALRLAELR* |
| Ga0075434_1017555282 | 3300006871 | Populus Rhizosphere | SGALRAALAASVLALMHEGAEAHLPNANVVAERLADIR* |
| Ga0075424_1018594671 | 3300006904 | Populus Rhizosphere | AVERTALRAALAASVAELMREGVEARLPHAGIVEERLAELR* |
| Ga0075435_1001006991 | 3300007076 | Populus Rhizosphere | ATEPDPLRAALAAAVGVLIREGEDANFPHADTVARRLAALQ* |
| Ga0066710_1001696591 | 3300009012 | Grasslands Soil | LGAVEPLALREALAASVLALMREGADARLLHAPAVAQRLAELH |
| Ga0066710_1024478822 | 3300009012 | Grasslands Soil | ETLARFENAHVGALEPEALRAALAASVSSLLHEGAEARLPHAETVAQGLAEFR |
| Ga0066710_1035338702 | 3300009012 | Grasslands Soil | TLARFEGAHVGAVEPGALRAALATSVLELMRAGAEAGLPDADTVAQRLAELR |
| Ga0066710_1042389282 | 3300009012 | Grasslands Soil | GALEPGALRAALAASVLALMREGAESRLPHAQVVAERLAEFR |
| Ga0099828_117261651 | 3300009089 | Vadose Zone Soil | DAHVGAVEPGALRAALAASVLALMHEGAEARLPHAHVVAERLGELR* |
| Ga0099827_109352292 | 3300009090 | Vadose Zone Soil | AHVGALEPGTLRAALAASVLALMGEGAEAGLPHADTVAQRLAEFR* |
| Ga0066709_1006671553 | 3300009137 | Grasslands Soil | ALRAALAASVLALLREGAEARLPHTDAVAQRLAELR* |
| Ga0105242_114009433 | 3300009176 | Miscanthus Rhizosphere | ATEPDPLRAALAASVGALMREGVDANLPHADTVGRRLAGLQ* |
| Ga0126304_101402221 | 3300010037 | Serpentine Soil | AHVGAVEPGALRAALAACVVALMRAGAEARLPHADTVAQRLAELG* |
| Ga0134084_103118941 | 3300010322 | Grasslands Soil | EILAQFEAAHVGAVEPGTLRAALAASVLVLMRVGAEAGLPHADTVAQRLAELR* |
| Ga0134086_104093471 | 3300010323 | Grasslands Soil | DALVGALKPGALRKALAASVLALMREGADARLPDAQVVAERLAELA* |
| Ga0134125_128320712 | 3300010371 | Terrestrial Soil | SLEPGVLRTALAASVLALMREGAEARLPHAEAVGQRLEGWR* |
| Ga0136620_104046131 | 3300012186 | Polar Desert Sand | GALRAALAASVLALMRAGAEARLPHADTVAQRLAELR* |
| Ga0137365_101937073 | 3300012201 | Vadose Zone Soil | LARSEDAHVGAVEPGALRAALAASVLALTREGAEARLPHARVVAERLAELY* |
| Ga0137374_105816861 | 3300012204 | Vadose Zone Soil | TLAPFGDTHIGAVEPGALRTALAASVLALMREGAETRLPHAHVVAARLAELH* |
| Ga0137381_110325452 | 3300012207 | Vadose Zone Soil | FEHAHVSAVEPGALRAALAASVLALMHEGTEAHLAHADVVAQRLAELR* |
| Ga0137376_117797231 | 3300012208 | Vadose Zone Soil | RAALAASVLALMHEGAEARLPHAHVVADRLGELH* |
| Ga0137379_103796842 | 3300012209 | Vadose Zone Soil | LARFEDAHVSAVEPGALRAALAASVLALMREGAEARLPHPEVVAQRLAELC* |
| Ga0137379_113012372 | 3300012209 | Vadose Zone Soil | FEDAHVGALEPGALRAALAASVLALTHEGAEARLPHAQVVAERLAELS* |
| Ga0137378_112146033 | 3300012210 | Vadose Zone Soil | YAHVGAAEPATLRAALAASVLALMREGAGARLPHSDTVAQHLADLC* |
| Ga0137377_106753491 | 3300012211 | Vadose Zone Soil | HVSAVEPGALRAALAASVLALMHEGTEARLPHADVVAERLAELR* |
| Ga0137386_111031121 | 3300012351 | Vadose Zone Soil | LRAALAASVLALMREGAEARLPHAQVVGQRLAELG* |
| Ga0157338_10129151 | 3300012515 | Arabidopsis Rhizosphere | QPDALREALAASVSALVEEAAAAELAGVEVVAERLAELRAL* |
| Ga0137373_105836462 | 3300012532 | Vadose Zone Soil | GAVERGVLRAALAASVLALMREGAEARLPPADTVAQRLAELH* |
| Ga0164303_112950202 | 3300012957 | Soil | ALAASVLALTREGSEARLPHAQVVAERLAELIVTS* |
| Ga0164304_101078693 | 3300012986 | Soil | ALRAALTASVLALTSEGVDAGLPHAQVVVNRLAELL* |
| Ga0157378_109721122 | 3300013297 | Miscanthus Rhizosphere | VGSLEPEALRAVLAASVVALTSEGIEAGLPHAQVVVNRLAELL* |
| Ga0120123_11767852 | 3300013770 | Permafrost | HAHVGATESEPLRAALAASVLALMREGADARLSHADVVARRLAELH* |
| Ga0120158_101470523 | 3300013772 | Permafrost | LARFEAAHVGALEPGALRAALAASVVALMREGEDARLPHADTVAQRLAELR* |
| Ga0182000_101609371 | 3300014487 | Soil | VEGLDPEALRSALAASVRELAHEGAGADLPVADVVAERLADLR* |
| Ga0173478_107630221 | 3300015201 | Soil | LRAALAASVLALTREGTEARLPHADVVAERLAELS* |
| Ga0132257_1014435031 | 3300015373 | Arabidopsis Rhizosphere | LAPEPMRRALAATVQALLLEGAEARLPHAAVVAARLGELT* |
| Ga0132257_1016837873 | 3300015373 | Arabidopsis Rhizosphere | ALEAEALRAALAASVAALEREGVEADLPNAHVVAECLAEIAR* |
| Ga0132257_1031863801 | 3300015373 | Arabidopsis Rhizosphere | QTLARSERAHIGAVEPGALKTALAAAVVALVHEGVEAHLPHAPVVAERLAELS* |
| Ga0134069_13284672 | 3300017654 | Grasslands Soil | LRAALAASVRALVGEGAKARLSHADVVSERLAELG |
| Ga0190266_103940641 | 3300017965 | Soil | RFAATHVGAHDPVALRAALAASVAALMREGEDLPAASVVADRLMELLRP |
| Ga0190266_105294881 | 3300017965 | Soil | VGALEPAALRTALAASVRELVREAFDARLPHADVVAQRLAALTD |
| Ga0184605_101866641 | 3300018027 | Groundwater Sediment | HVGALEPAALRAALAAVVVALTREGAEARLPHAQVVAERLAGLR |
| Ga0184620_102289402 | 3300018051 | Groundwater Sediment | LRAALAAVVVALTREGAEARLPHAQVVAERLAGLR |
| Ga0184621_101180582 | 3300018054 | Groundwater Sediment | EDAHVAAVEPGALGAALAASVLALMREGAETRLPHAHVVAARLAELP |
| Ga0184621_102968802 | 3300018054 | Groundwater Sediment | DVSAVEPGPLRAALAASVLALMREGAEARLRHADVVAQRLAELR |
| Ga0184618_101816061 | 3300018071 | Groundwater Sediment | RAALAASVLALMHEGAEARLPHANVVAQRLAELSSASR |
| Ga0184625_101951832 | 3300018081 | Groundwater Sediment | ARFEDAHVGAVEPGALRPALAASVLALTREGSEARLPNAQVVAERLAELR |
| Ga0190265_130480981 | 3300018422 | Soil | GALRAALAAASRELLREGADADVPQAAVVASRLDELSRPG |
| Ga0066655_102798643 | 3300018431 | Grasslands Soil | ARFEHAHVSVIEPGPLRAALAASVLALVREGAEARLPHADVVAQRLAELC |
| Ga0173481_104098832 | 3300019356 | Soil | VATTRPASLRVALAASVSALLDEGLDAGLACSPVVAERLAELH |
| Ga0210378_101662082 | 3300021073 | Groundwater Sediment | EDAHVSALEPRALRAALSASVLALMCEGAEARLPHADVVAQRLAALL |
| Ga0222623_103244811 | 3300022694 | Groundwater Sediment | ETLARFEHAHVSALEPGPLRAALVASVLALMREGAEARLPHADIVAQRLAELR |
| Ga0207687_114676982 | 3300025927 | Miscanthus Rhizosphere | TETLARYEDAHIGSLEPAALRAALAASVVALTAEGTEADIPHAQVVADRLAELR |
| Ga0207706_103916581 | 3300025933 | Corn Rhizosphere | EALRAVLAASVVALTREGTEADIPHAQVVAERLAELR |
| Ga0207661_109252371 | 3300025944 | Corn Rhizosphere | PEALRHALAASVTALVDTAAEADLPHADVVADRLAEFSAAANVPQ |
| Ga0207648_122432811 | 3300026089 | Miscanthus Rhizosphere | LEPEALRAVLAASVVALTREGTEADIPHAQVVAERLAELR |
| Ga0209807_13139421 | 3300026530 | Soil | ALRAALAASVLALMREGADARLPRADVVAERLADLR |
| Ga0208217_1000952 | 3300026650 | Soil | EAGALRAALAACVVALLRAGTEAHLPHAETVAQRLVELC |
| Ga0209899_10096984 | 3300027490 | Groundwater Sand | ALRAALAASVLALVREGRETRLPNAHVVAARLAEFH |
| Ga0209689_11595643 | 3300027748 | Soil | VEPGALRAALAASVLALMRAGAEARLPQADTVAQRLAELR |
| Ga0307295_101918603 | 3300028708 | Soil | PAALRKALAAAVLALMHEGSEAQLPHAETVAQRLAELR |
| Ga0307313_101021602 | 3300028715 | Soil | LARFEDAHVSVVEPGALRAALAASVLALMREGAEARLPHADAVAHRLAELH |
| Ga0307319_101152031 | 3300028722 | Soil | EPEALRAALAASVLELMRAGAEARLPHADTVAQRLAELR |
| Ga0307316_100986693 | 3300028755 | Soil | EGEPLSTALAVSVVALIREGAEARLPHADVVAQRLAELR |
| Ga0307282_101943291 | 3300028784 | Soil | PTALRAALAASVRSLMREGAEARLPHAPIVAERLAEFRSLMAG |
| Ga0307282_105745752 | 3300028784 | Soil | LARFDDAHVGATEPELLRTALAASLLALMREGAEARLPHADVVAQRLAELH |
| Ga0307287_103522382 | 3300028796 | Soil | HVSAVEPGALRAALAAAVLALLREGAEARLPHADVVAERLTDLS |
| Ga0307284_100247204 | 3300028799 | Soil | PLRAALIASVLALIREGAEARLPHADVVAQRLAELG |
| Ga0307292_100683064 | 3300028811 | Soil | TLARSEDAHVGALEPAALRAALAAVVVALTREGAEARLPHAQVVAERLAGLR |
| Ga0307302_102916711 | 3300028814 | Soil | FEAAHVGALEPGALRAALAASVLALMRAGAEARLPHADSVAQRLAELR |
| Ga0307302_103002831 | 3300028814 | Soil | GALRAALAASVLALMRAGAEARLPHADTVAQRLAELH |
| Ga0307310_100151913 | 3300028824 | Soil | ARSEDAHVGALEPAALRAALAAVVVALTREGAEARLPHAQVVAERLAGLR |
| Ga0307308_103583821 | 3300028884 | Soil | VTALEPGPLRAALIASVLALIREGAEARLPHADVVAQRLAELG |
| Ga0307308_105464471 | 3300028884 | Soil | LARFEDAHVRAVEPGALRAALAASVLALMHEGAEARLPHADAVAHRLAELR |
| Ga0307304_103356801 | 3300028885 | Soil | LTWFEDAHVTALEPGPLRAALIASVLALIREGAEARLPHADVVAQRLAELG |
| Ga0268253_100353311 | 3300030514 | Agave | AHVGAVEAGALRAALAAGVVGLLRAGAEARLPHAETVAQRLAELG |
| Ga0310890_112181111 | 3300032075 | Soil | DALARFEGAHVGTVEPGALRAALAASVRELIREGAAARLPHAEVVGERLAELR |
| Ga0268251_101844831 | 3300032159 | Agave | AGALRAALAAGVVGLLRAGAEARLPHAETVAQRLVELC |
| Ga0307470_114105372 | 3300032174 | Hardwood Forest Soil | APFEDAHVASLEPGVLRTALGASVLALTREGAEARLPHAEAVGQRLEGWR |
| ⦗Top⦘ |