


| Basic Information | |
|---|---|
| Family ID | F095216 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MMAVRLLYALALLNLLVLLSDALYNVLGGLLPLGH |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.38 % |
| % of genes near scaffold ends (potentially truncated) | 6.67 % |
| % of genes from short scaffolds (< 2000 bps) | 72.38 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.048 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF09678 | Caa3_CtaG | 20.00 |
| PF13442 | Cytochrome_CBB3 | 19.05 |
| PF07681 | DoxX | 1.90 |
| PF07978 | NIPSNAP | 1.90 |
| PF03597 | FixS | 1.90 |
| PF02803 | Thiolase_C | 0.95 |
| PF01594 | AI-2E_transport | 0.95 |
| PF01551 | Peptidase_M23 | 0.95 |
| PF00296 | Bac_luciferase | 0.95 |
| PF12831 | FAD_oxidored | 0.95 |
| PF00912 | Transgly | 0.95 |
| PF04392 | ABC_sub_bind | 0.95 |
| PF01523 | PmbA_TldD | 0.95 |
| PF13439 | Glyco_transf_4 | 0.95 |
| PF01636 | APH | 0.95 |
| PF16327 | CcmF_C | 0.95 |
| PF00115 | COX1 | 0.95 |
| PF00355 | Rieske | 0.95 |
| PF08020 | DUF1706 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.90 |
| COG3197 | Cytochrome oxidase maturation protein, CcoS/FixS family | Posttranslational modification, protein turnover, chaperones [O] | 1.90 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.90 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.95 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.95 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.95 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.95 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.95 |
| COG4283 | Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain | General function prediction only [R] | 0.95 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.14 % |
| Unclassified | root | N/A | 2.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005543|Ga0070672_101592680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005552|Ga0066701_10344540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
| 3300005556|Ga0066707_10687647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 643 | Open in IMG/M |
| 3300005713|Ga0066905_100303585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1255 | Open in IMG/M |
| 3300005764|Ga0066903_101413281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300005764|Ga0066903_101665946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 1213 | Open in IMG/M |
| 3300006031|Ga0066651_10518557 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006049|Ga0075417_10206786 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006049|Ga0075417_10752203 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006796|Ga0066665_10570538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300006845|Ga0075421_100024318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7633 | Open in IMG/M |
| 3300006845|Ga0075421_100031827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 6678 | Open in IMG/M |
| 3300006845|Ga0075421_100342872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 1807 | Open in IMG/M |
| 3300006845|Ga0075421_100809533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300006865|Ga0073934_10000304 | All Organisms → cellular organisms → Bacteria | 145770 | Open in IMG/M |
| 3300006865|Ga0073934_10004915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21489 | Open in IMG/M |
| 3300007004|Ga0079218_11846993 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300009012|Ga0066710_100064311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4658 | Open in IMG/M |
| 3300009012|Ga0066710_100588376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1687 | Open in IMG/M |
| 3300009038|Ga0099829_10455404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300009088|Ga0099830_11225947 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009089|Ga0099828_10651199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 947 | Open in IMG/M |
| 3300009137|Ga0066709_100219773 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300009147|Ga0114129_10002110 | All Organisms → cellular organisms → Bacteria | 27384 | Open in IMG/M |
| 3300009157|Ga0105092_10009579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5077 | Open in IMG/M |
| 3300009157|Ga0105092_10693732 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009777|Ga0105164_10295014 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009807|Ga0105061_1083700 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009807|Ga0105061_1089780 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010043|Ga0126380_11069328 | Not Available | 685 | Open in IMG/M |
| 3300010304|Ga0134088_10337727 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010362|Ga0126377_11681033 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012081|Ga0154003_1068783 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012096|Ga0137389_10129321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2045 | Open in IMG/M |
| 3300012096|Ga0137389_11493862 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012202|Ga0137363_11163415 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012202|Ga0137363_11412919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300012203|Ga0137399_10070402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2621 | Open in IMG/M |
| 3300012204|Ga0137374_10010873 | All Organisms → cellular organisms → Bacteria | 10690 | Open in IMG/M |
| 3300012204|Ga0137374_10046489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4520 | Open in IMG/M |
| 3300012204|Ga0137374_10053525 | All Organisms → cellular organisms → Bacteria | 4128 | Open in IMG/M |
| 3300012204|Ga0137374_10135657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2231 | Open in IMG/M |
| 3300012206|Ga0137380_10185950 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300012207|Ga0137381_11542078 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012350|Ga0137372_10154138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1874 | Open in IMG/M |
| 3300012351|Ga0137386_10075347 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300012355|Ga0137369_10237733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1385 | Open in IMG/M |
| 3300012355|Ga0137369_10320626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1142 | Open in IMG/M |
| 3300012357|Ga0137384_11221632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300012358|Ga0137368_10186778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1488 | Open in IMG/M |
| 3300012360|Ga0137375_10018485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8121 | Open in IMG/M |
| 3300012360|Ga0137375_10246151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1654 | Open in IMG/M |
| 3300012360|Ga0137375_10765818 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012360|Ga0137375_11166248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa roseopersicina | 592 | Open in IMG/M |
| 3300012362|Ga0137361_10133282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2202 | Open in IMG/M |
| 3300012582|Ga0137358_10021446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4167 | Open in IMG/M |
| 3300012929|Ga0137404_10156944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1897 | Open in IMG/M |
| 3300012976|Ga0134076_10516829 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300014259|Ga0075311_1087169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
| 3300014318|Ga0075351_1087814 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300014885|Ga0180063_1086253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 945 | Open in IMG/M |
| 3300015259|Ga0180085_1079130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
| 3300015359|Ga0134085_10092703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
| 3300017997|Ga0184610_1097830 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300018084|Ga0184629_10296790 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300018422|Ga0190265_10038285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4063 | Open in IMG/M |
| 3300018433|Ga0066667_11283148 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018468|Ga0066662_10994500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 830 | Open in IMG/M |
| 3300019360|Ga0187894_10197135 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300019360|Ga0187894_10198744 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300019377|Ga0190264_11576287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300019458|Ga0187892_10001051 | All Organisms → cellular organisms → Bacteria | 66770 | Open in IMG/M |
| 3300019458|Ga0187892_10010821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11414 | Open in IMG/M |
| 3300019458|Ga0187892_10329320 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300020063|Ga0180118_1306130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 710 | Open in IMG/M |
| 3300025310|Ga0209172_10003881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21565 | Open in IMG/M |
| 3300025313|Ga0209431_10879716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300025912|Ga0207707_10587074 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300025922|Ga0207646_11317497 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300026535|Ga0256867_10000455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16224 | Open in IMG/M |
| 3300027384|Ga0209854_1095078 | Not Available | 532 | Open in IMG/M |
| 3300027650|Ga0256866_1177363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300027695|Ga0209966_1041840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 957 | Open in IMG/M |
| 3300027835|Ga0209515_10008910 | All Organisms → cellular organisms → Bacteria | 11563 | Open in IMG/M |
| 3300027873|Ga0209814_10061582 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300027909|Ga0209382_10000563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 61245 | Open in IMG/M |
| 3300027909|Ga0209382_10962610 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300027909|Ga0209382_10986472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
| 3300027909|Ga0209382_12295456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300028589|Ga0247818_10868331 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028792|Ga0307504_10073361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1033 | Open in IMG/M |
| 3300030336|Ga0247826_10414336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1130914 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031184|Ga0307499_10283835 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031548|Ga0307408_100014397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5254 | Open in IMG/M |
| 3300031548|Ga0307408_100068467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2614 | Open in IMG/M |
| 3300031548|Ga0307408_101431979 | Not Available | 651 | Open in IMG/M |
| 3300031820|Ga0307473_10040181 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300031892|Ga0310893_10417456 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031949|Ga0214473_12126671 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032005|Ga0307411_10083465 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300033417|Ga0214471_10161081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1849 | Open in IMG/M |
| 3300033417|Ga0214471_10695607 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300033551|Ga0247830_10517935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
| 3300034176|Ga0364931_0093873 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.81% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.86% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.95% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.95% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.95% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.95% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070672_1015926802 | 3300005543 | Miscanthus Rhizosphere | MTGVRLLRALALVNLLVLVGDILYNVFGGLLPMLQR* |
| Ga0066701_103445402 | 3300005552 | Soil | MRAVRLLYALALANLLILLSDVLYNVLGGLLPLMR* |
| Ga0066707_106876473 | 3300005556 | Soil | RPGACAMMAVRLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0066905_1003035854 | 3300005713 | Tropical Forest Soil | MSGVRLIYALAIVNLVMLLADVLYNVLGSLLTMGP* |
| Ga0066903_1014132813 | 3300005764 | Tropical Forest Soil | MTGVRLLLALALLNVLLLLSDVLYNVLGGLVPLLR* |
| Ga0066903_1016659464 | 3300005764 | Tropical Forest Soil | MSGVRLLHALALLNLLLLLSDVLYNVLGGLLPLLRQ* |
| Ga0066651_105185571 | 3300006031 | Soil | VGGPRPGAGSMMALRVLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0075417_102067863 | 3300006049 | Populus Rhizosphere | MTGIRLIRALALANLLILLGDILYNVFGGLLPMLK* |
| Ga0075417_107522032 | 3300006049 | Populus Rhizosphere | MTGVRLLYALAIVNLLILASDVLYNVLSGLWPMLR* |
| Ga0066665_105705384 | 3300006796 | Soil | MMAVRLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0075421_1000243187 | 3300006845 | Populus Rhizosphere | MMAVRLVLALALLNLLILLGDALYNVFGGLGPLLR* |
| Ga0075421_1000318275 | 3300006845 | Populus Rhizosphere | MTGVRLLRALALVNLLILLGDILYNVLGGLLPMLR* |
| Ga0075421_1003428724 | 3300006845 | Populus Rhizosphere | MIAVRLLLALALLNLLILFGDALYNVFGGFAPLLR* |
| Ga0075421_1008095333 | 3300006845 | Populus Rhizosphere | MTGVRLLRVLALANLLILLGDILYNIFGALLPMTR* |
| Ga0073934_1000030448 | 3300006865 | Hot Spring Sediment | MSGIRLLWALSIVNLLVLLGDVLFNVLGVLLGAE* |
| Ga0073934_1000491522 | 3300006865 | Hot Spring Sediment | MTGVRLLWALSLVNLAILVADVLYNVLGGLLAAMP* |
| Ga0079218_118469934 | 3300007004 | Agricultural Soil | MTDVRLLRLVAVVNLLILAADIVYNVLGGLLPMLR* |
| Ga0066710_1000643116 | 3300009012 | Grasslands Soil | MRAVRLLYALALANLLILLSDVLYNVLGGFLPLMR |
| Ga0066710_1005883763 | 3300009012 | Grasslands Soil | MMAVRLLYALALLNLLVLLTDALYNVFGGLLSRVH |
| Ga0099829_104554043 | 3300009038 | Vadose Zone Soil | MMAVRLLYALALLNLLVLLSDALYNVLGGLLSLVH* |
| Ga0099830_112259473 | 3300009088 | Vadose Zone Soil | MIAVRLLYALALLNLLLLLSDALYNVAGALLAAAR* |
| Ga0099828_106511993 | 3300009089 | Vadose Zone Soil | RPGVGSMMAVRLLYALALLNLLVLLSDALYNVLGGFLPLGR* |
| Ga0066709_1002197734 | 3300009137 | Grasslands Soil | MMAVRLLYALALLNLLVLLTDALYNVFGGLLSRVH* |
| Ga0114129_100021105 | 3300009147 | Populus Rhizosphere | MTAVRLVLALALLNLLILVGDALYNVFGGFAPLLR* |
| Ga0105092_100095796 | 3300009157 | Freshwater Sediment | MTGIRLLRALAVANLLVLLGDILYNVFGALLPMVR* |
| Ga0105092_106937322 | 3300009157 | Freshwater Sediment | MAVRLLLTLALLNLAILVGDALYNVFGGFAPLLR* |
| Ga0105164_102950143 | 3300009777 | Wastewater | MTAVRVLYALAVLNLVVLLAEALYNLVGTVLPAAR* |
| Ga0105061_10837002 | 3300009807 | Groundwater Sand | VTTVRIFAALALLNLLILLGDILYNVLGGLVPLIR* |
| Ga0105061_10897802 | 3300009807 | Groundwater Sand | MALRLLYALALLNLAILLIDGLYNVLGGLWPLLR* |
| Ga0126380_110693283 | 3300010043 | Tropical Forest Soil | MMVRLLYVLALLNLVILLIDALYNVLGGLWPLLG* |
| Ga0134088_103377273 | 3300010304 | Grasslands Soil | MMAVRLLYALALLNLLVLLSDALYNVLGGLLSLAH* |
| Ga0126377_116810331 | 3300010362 | Tropical Forest Soil | MMVRLLYVLALLNLVILLIDALYNVLGGLWPLLR* |
| Ga0154003_10687832 | 3300012081 | Attine Ant Fungus Gardens | MIGVRLLYALALINLAVLLGDVLYNVLGVVTAGR* |
| Ga0137389_101293213 | 3300012096 | Vadose Zone Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGFLPLGR* |
| Ga0137389_114938623 | 3300012096 | Vadose Zone Soil | MAIRLLSTLALLNLLVLLSDVLYNVLGGLVPLLRH* |
| Ga0137363_111634153 | 3300012202 | Vadose Zone Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGVLPLGH* |
| Ga0137363_114129191 | 3300012202 | Vadose Zone Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0137399_100704023 | 3300012203 | Vadose Zone Soil | VNGVRLLYVLAIVNLLVLLGDVLYNVLGGLLTLAR* |
| Ga0137374_100108738 | 3300012204 | Vadose Zone Soil | MAVRLLRALALLNLLFLLSDALYNVLGGLVPLIR* |
| Ga0137374_100464895 | 3300012204 | Vadose Zone Soil | MAIRLLYALALVNLLFLLSDALYNVLGGLLPLVRY* |
| Ga0137374_100535253 | 3300012204 | Vadose Zone Soil | MTGVRLLYILAVLNLLFLLSDALYSVLGGLLPMVR* |
| Ga0137374_101356571 | 3300012204 | Vadose Zone Soil | MMAARLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0137380_101859504 | 3300012206 | Vadose Zone Soil | MAVRLLYALALLNLLVLLSDALYNILGGLLPLGH* |
| Ga0137381_115420783 | 3300012207 | Vadose Zone Soil | MMVVRLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0137372_101541381 | 3300012350 | Vadose Zone Soil | MMAVRLLRALALLNLLFLLSDALYNVLGGLVPLIR* |
| Ga0137386_100753473 | 3300012351 | Vadose Zone Soil | MLAVRLLYALALLNLLVLLTDALYNVFGGLLSRVH* |
| Ga0137369_102377334 | 3300012355 | Vadose Zone Soil | MRAIRLLYALALANLLILLSDVLYNVLGGLLPLVR* |
| Ga0137369_103206262 | 3300012355 | Vadose Zone Soil | MRVARLLYALALANLLILLSDVLYNVLGGLLPLVR* |
| Ga0137384_112216323 | 3300012357 | Vadose Zone Soil | CSMMAARLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0137368_101867782 | 3300012358 | Vadose Zone Soil | MRAIWLLYALALANLLILLSDVLYNVLGGLLPLVR* |
| Ga0137375_100184855 | 3300012360 | Vadose Zone Soil | MMAIRLLYALALVNLLFLLSDALYNVLGGLLPLVRY* |
| Ga0137375_102461514 | 3300012360 | Vadose Zone Soil | MAIRLLYALALLNLLVLLSDALYNVLGGLLPLGH* |
| Ga0137375_107658183 | 3300012360 | Vadose Zone Soil | MAVRLLYVLALLNLLFLVSDVLYNVLGGLLPLVR* |
| Ga0137375_111662481 | 3300012360 | Vadose Zone Soil | MMAARLLYALALLNLLVLLSDALYNVLGGLRPLGH* |
| Ga0137361_101332824 | 3300012362 | Vadose Zone Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGFLPLGH* |
| Ga0137358_100214465 | 3300012582 | Vadose Zone Soil | MRAVRLLYALALANLLILLSDVLYNVLGGLLPLVR* |
| Ga0137404_101569444 | 3300012929 | Vadose Zone Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGLLSLVH* |
| Ga0134076_105168293 | 3300012976 | Grasslands Soil | MMAVRLLYALALLNLLVLLSAALYNVLGGLLSLAH* |
| Ga0075311_10871692 | 3300014259 | Natural And Restored Wetlands | MTGIRLLRALAVANLLVLLGDILYNVFGGLLPMVR* |
| Ga0075351_10878143 | 3300014318 | Natural And Restored Wetlands | MTAVRLVLALAVLNLVVLAADALYNVFGGLVSLLW* |
| Ga0180063_10862533 | 3300014885 | Soil | MTGVRLLYILAVLNLLILLSDALYNVLGGLLPMVR* |
| Ga0180085_10791304 | 3300015259 | Soil | MTGVRLLYILAVLNLLILLSDALYNVLGGLVPMVR* |
| Ga0134085_100927032 | 3300015359 | Grasslands Soil | MMAVRLLYALALLNLLVLLSDALYNVLGGLLFLAH* |
| Ga0184610_10978303 | 3300017997 | Groundwater Sediment | MIAVRLVLVLALLNLLILLGDALYNVLGGFGPLLR |
| Ga0184629_102967904 | 3300018084 | Groundwater Sediment | MTGVRLLYILAVLNLLILLSDALYNVLGGLLPMVR |
| Ga0190265_100382854 | 3300018422 | Soil | MTGIRLLRALALANLLVLLGDILYNIFGGLLPMIR |
| Ga0066667_112831483 | 3300018433 | Grasslands Soil | MMAVRLLYALALLNLLVLLSDALYNVLGGLLPLGH |
| Ga0066662_109945001 | 3300018468 | Grasslands Soil | MMAVRLLYALAVLNLLVLLSDALYNVLGGFLPLGH |
| Ga0187894_101971352 | 3300019360 | Microbial Mat On Rocks | MTAIRLLQALAVLNLLLLLGDALYNVLGGLLPFVR |
| Ga0187894_101987442 | 3300019360 | Microbial Mat On Rocks | MTGIRLLRVLALVNLLILIGDVLYNVFGGLLPMVR |
| Ga0190264_115762873 | 3300019377 | Soil | MTGIRLLRVLALANLLILLGDILYNIFGALLPMTR |
| Ga0187892_1000105116 | 3300019458 | Bio-Ooze | VTALRLLYALALLNLLILLVDGLYNVLGGLLPLLR |
| Ga0187892_1001082110 | 3300019458 | Bio-Ooze | VSPLRLLYALALLNLAILLIDMLYNVLGGLVPLLR |
| Ga0187892_103293203 | 3300019458 | Bio-Ooze | MIAVRLILALALLNLVILASDLLYNLVGGLLPLVR |
| Ga0180118_13061304 | 3300020063 | Groundwater Sediment | MTGVRLLYALALANLLFLASDVLYNVLAGLLPLIR |
| Ga0209172_100038814 | 3300025310 | Hot Spring Sediment | MTGVRLLWALSLVNLAILVADVLYNVLGGLLAAMP |
| Ga0209431_108797162 | 3300025313 | Soil | MTGIRLLRALALVNLLILLADILYNVFGGLLPMVQ |
| Ga0207707_105870743 | 3300025912 | Corn Rhizosphere | MTGVRLLRALALVNLLVLVGDILYNVFGGLLPMLQR |
| Ga0207646_113174972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAVRLLYALALLNLLVLLSDALYNVLGGLLSLVH |
| Ga0256867_1000045512 | 3300026535 | Soil | MTGIRLLRALAVANLLVLLGDILYNVFGALLPMVR |
| Ga0209854_10950781 | 3300027384 | Groundwater Sand | GPRPGAGPMTAVRILYVLAVLNLLFLLSDALYNVLGGLLPMVR |
| Ga0256866_11773633 | 3300027650 | Soil | MRGIRLLRALAIANLLVLLADVLYNVLGGLLPMVR |
| Ga0209966_10418404 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MTGVRLLRALALVNLLILLGDILYNVLGGLLPMLR |
| Ga0209515_100089104 | 3300027835 | Groundwater | MTAVRVLYALAVLNLVVLLAEALYNLVGTVLPAGR |
| Ga0209814_100615822 | 3300027873 | Populus Rhizosphere | MTAVRLVLALALLNLLILVGDALYNVFGGFAPLLR |
| Ga0209382_1000056337 | 3300027909 | Populus Rhizosphere | MTGIRLIRALALANLLILLGDILYNVFGGLLPMLK |
| Ga0209382_109626103 | 3300027909 | Populus Rhizosphere | MIAVRLLLALALLNLLILFGDALYNVFGGFAPLLR |
| Ga0209382_109864723 | 3300027909 | Populus Rhizosphere | MTGVRLLRVLALANLLILLGDILYNIFGALLPMTR |
| Ga0209382_122954561 | 3300027909 | Populus Rhizosphere | MMAVRLVLALALLNLLILLGDALYNVFGGLGPLLR |
| Ga0247818_108683312 | 3300028589 | Soil | MTAVRVMLALAVLNLLILLGDALYNVLGGLAFFPR |
| Ga0307504_100733614 | 3300028792 | Soil | MTGVRLLYILAVLNLLFLLSDVLYNVLGGLLPMVR |
| Ga0247826_104143362 | 3300030336 | Soil | MIAVRLLLVLALVNLLILIGDALYNVLGGFGPLLR |
| (restricted) Ga0255311_11309143 | 3300031150 | Sandy Soil | MMAVRLLYALALLNLVLLLSDVLYNVLGGLLPLVRD |
| Ga0307499_102838353 | 3300031184 | Soil | MTVVRLLLALALLNLLILVSDALYNVFGGLVPLLR |
| Ga0307408_1000143973 | 3300031548 | Rhizosphere | MTGVRLLRLVAVVNLLILAADIVYNVLGGLLPMLW |
| Ga0307408_1000684672 | 3300031548 | Rhizosphere | MRAIRLLYALALANLLILLSDVLYNVLGGLLPLVR |
| Ga0307408_1014319793 | 3300031548 | Rhizosphere | MTGIRLLRALALVNLLVLLGDILYNVLGGLLPLVW |
| Ga0307473_100401813 | 3300031820 | Hardwood Forest Soil | MSGARLIYVLALLNLLILLGDVLYNVLGGLVEMAR |
| Ga0310893_104174563 | 3300031892 | Soil | GPGAMTGVRLLRALALVNLLVLVGDILYNVFGGLLPMLQR |
| Ga0214473_121266713 | 3300031949 | Soil | MTAVRVLYALAVLNLVVLLAEALYNLAGTVLPAAR |
| Ga0307411_100834651 | 3300032005 | Rhizosphere | AMTGIRLLRALALVNLLVLLGDILYNVLGGLLPLVW |
| Ga0214471_101610813 | 3300033417 | Soil | MMAVRLVLALALLNLLILVGDALYNVLGGFVPLLR |
| Ga0214471_106956074 | 3300033417 | Soil | MTGVRLLYILAVLNLLFLLSDALYNVLGGLLPMVR |
| Ga0247830_105179353 | 3300033551 | Soil | MTGIRLLRVLALANLLILLGDILYNILGALLPMTR |
| Ga0364931_0093873_520_627 | 3300034176 | Sediment | MTAVRLVLMLAVLNLVLLAADALYNVFGGLLSLLR |
| ⦗Top⦘ |