


| Basic Information | |
|---|---|
| Family ID | F095151 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTDFSKYKNITVDNDTYATITKLQTKLAPDVKLSRSQVVKT |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 78.95 % |
| % of genes near scaffold ends (potentially truncated) | 13.33 % |
| % of genes from short scaffolds (< 2000 bps) | 14.29 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (89.524 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (55.238 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 17.14 |
| PF01832 | Glucosaminidase | 2.86 |
| PF01612 | DNA_pol_A_exo1 | 0.95 |
| PF02675 | AdoMet_dc | 0.95 |
| PF00961 | LAGLIDADG_1 | 0.95 |
| PF01370 | Epimerase | 0.95 |
| PF00476 | DNA_pol_A | 0.95 |
| PF13578 | Methyltransf_24 | 0.95 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.95 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 89.52 % |
| All Organisms | root | All Organisms | 10.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001748|JGI11772J19994_1020099 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 982 | Open in IMG/M |
| 3300006802|Ga0070749_10645500 | Not Available | 568 | Open in IMG/M |
| 3300006802|Ga0070749_10698341 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 542 | Open in IMG/M |
| 3300007234|Ga0075460_10256049 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 582 | Open in IMG/M |
| 3300007539|Ga0099849_1325319 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 551 | Open in IMG/M |
| 3300007640|Ga0070751_1309284 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 587 | Open in IMG/M |
| 3300010297|Ga0129345_1112313 | Not Available | 1003 | Open in IMG/M |
| 3300010413|Ga0136851_11932712 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 564 | Open in IMG/M |
| 3300010994|Ga0139328_119044 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 658 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10448366 | Not Available | 831 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10042571 | Not Available | 4568 | Open in IMG/M |
| 3300018080|Ga0180433_10092681 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 2631 | Open in IMG/M |
| 3300020179|Ga0194134_10007469 | Not Available | 9443 | Open in IMG/M |
| 3300021959|Ga0222716_10385998 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-3 | 818 | Open in IMG/M |
| 3300021961|Ga0222714_10172081 | Not Available | 1276 | Open in IMG/M |
| 3300022167|Ga0212020_1087318 | Not Available | 522 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1030998 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3541 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1179219 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300028189|Ga0257127_1165328 | Not Available | 600 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.43% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.76% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.86% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.86% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.86% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.90% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.95% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.95% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.95% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.95% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.95% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.95% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.95% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.95% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.95% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010994 | ECM14MPS05_Bassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method B (2X150bp) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| QL_na_6329910 | 2022920000 | Saline Water | MTDKSKYSNVTVDNQTYAIITKLQTKLVPEVTLSRSQVIKTI |
| DelMOWin2010_100356401 | 3300000117 | Marine | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSR |
| JGI11772J19994_10120861 | 3300001748 | Saline Water And Sediment | MTDFSKYKNITVDNETYATVTRLQTKMTPDVKLSR |
| JGI11772J19994_10200995 | 3300001748 | Saline Water And Sediment | MTDFSKYKNITVDKDTYATLQMQTKLADNVKLSRSQVVKTLVQE |
| JGI25907J50239_10324514 | 3300003394 | Freshwater Lake | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSRSQVIKLS* |
| Ga0070749_106455003 | 3300006802 | Aqueous | MTDFSKYKNVTVDNDTYSIITKLQTKLKDDVKLSRSQVVKTLV |
| Ga0070749_106983411 | 3300006802 | Aqueous | MTDRSKYSNVTVDNKTYEIITKLQTKLIPDMKISRSQ |
| Ga0070746_102104841 | 3300006919 | Aqueous | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRSQ |
| Ga0098036_10760994 | 3300006929 | Marine | MTDFTRYKNVTVDKKTYETITKMQTKLTPDTKLSRSQVVTSLVNE |
| Ga0075460_102081401 | 3300007234 | Aqueous | MTDFSKYKNVTVDNDTYSIITKLQTKLKDDVKLSRSQVVKTLVTE |
| Ga0075460_102560491 | 3300007234 | Aqueous | MTDFSKYKNITVDNETYVTVTKLQTKMTPDVKLSRSQVI |
| Ga0070753_10988666 | 3300007346 | Aqueous | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRSQVVKT |
| Ga0099849_12209354 | 3300007539 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVK |
| Ga0099849_12233041 | 3300007539 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVKTLV |
| Ga0099849_13253191 | 3300007539 | Aqueous | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISR |
| Ga0099848_12606913 | 3300007541 | Aqueous | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISRSQVIKQ |
| Ga0099846_12770133 | 3300007542 | Aqueous | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISRSQVIKQII |
| Ga0070751_13092841 | 3300007640 | Aqueous | MTDFSKYKNITVDNETYVTVTKLQTKMTPDVKLSRSQVIK |
| Ga0099850_13409653 | 3300007960 | Aqueous | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISRSQV |
| Ga0114363_10711874 | 3300008266 | Freshwater, Plankton | MTDFSKYKNITVDNDTYAIVTKLQTKLKKDIKLSRSQVIKTL |
| Ga0102960_12666132 | 3300009000 | Pond Water | MTDFNKYKNVTVDNETYATITKLQTKLKDDVKLSRSQVVKTLVTEKAR |
| Ga0105098_104505414 | 3300009081 | Freshwater Sediment | MTDFNKYKNITVDNDTYGFVTKLQTKLKKDIKLSRSQ |
| Ga0114970_103496311 | 3300009163 | Freshwater Lake | MTDFSKYKNITVDNDTYAIVTKLQTKLKSDVKLSRSQ |
| Ga0114975_106938381 | 3300009164 | Freshwater Lake | MTDFSKYKNITVDNDTYGLVTRLQTKLKRDVKLSRSQVIKTLVNEK |
| Ga0114902_11387191 | 3300009413 | Deep Ocean | MTDFSKYKNITVDNDTYATITKLQTKITQDVKLSRSQVVKTL |
| Ga0115569_105171673 | 3300009497 | Pelagic Marine | MTDFTKYKNITVDHATYETITKLQTKLTTDVKLSRSQVVK |
| Ga0129345_11123134 | 3300010297 | Freshwater To Marine Saline Gradient | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISRS |
| Ga0129351_11134636 | 3300010300 | Freshwater To Marine Saline Gradient | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVKTLVQ |
| Ga0136655_10701326 | 3300010316 | Freshwater To Marine Saline Gradient | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVV |
| Ga0129333_108725992 | 3300010354 | Freshwater To Marine Saline Gradient | MTDFSKYKNITVDNDTYAIVTKLQTKLKSDVKLSRSQVIK |
| Ga0129333_115916303 | 3300010354 | Freshwater To Marine Saline Gradient | MTDFSKYKNVTVDNDTYTIITKLQTKMTPDVKLSRSQVVKTL |
| Ga0136851_119327123 | 3300010413 | Mangrove Sediment | MTDFSKYKNITVDKDTYGTITKMQTKLAENVKLSRS |
| Ga0139328_1190441 | 3300010994 | Sediment | MTDFSKYKNVTVDNDTYATITKMQTKLKKDIKLSRSQV |
| (restricted) Ga0172367_101525383 | 3300013126 | Freshwater | MTDFSKYKNITVDNQTYAIVTKLQTRLKRDVKLSRSQVVKTLVKEKARNLNGSLK* |
| (restricted) Ga0172365_102326604 | 3300013127 | Sediment | MTDFNKYKNITVDNHTYAIVTKLQTKLKKDVKLSRSQVI |
| (restricted) Ga0172363_104483661 | 3300013130 | Sediment | KVKMTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK* |
| (restricted) Ga0172372_109161702 | 3300013132 | Freshwater | MTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIK |
| (restricted) Ga0172375_100425713 | 3300013137 | Freshwater | MTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK* |
| (restricted) Ga0172371_108361913 | 3300013138 | Freshwater | VKMTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK* |
| Ga0177922_112578193 | 3300013372 | Freshwater | MTDFNKYKNITVDNDTYATVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK* |
| Ga0119960_10350931 | 3300014811 | Aquatic | MTDFNKYRNITVDKDTYGIVTKLQTKLKEDIKLSRSQVIKTLVNESVRS*LGN |
| Ga0181415_11317751 | 3300017732 | Seawater | MTDFTKYKNITVDHATYETITKLQTKLTTDVKLSRS |
| Ga0181400_11683131 | 3300017752 | Seawater | MTDFSKYKNITVDNDTYATITRLQTKITPDVKLSRSQVVKTL |
| Ga0181382_11490231 | 3300017756 | Seawater | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRS |
| Ga0181382_11805441 | 3300017756 | Seawater | MTDFTRYKNVTVDKKTYETITKMQTKLTPDTKLSRSQ |
| Ga0181386_10648132 | 3300017773 | Seawater | MTDFTKYKNITVDHATYETITKLQTKLTTDIKLSRSQVVKTLVKEKARELNGKLSK |
| Ga0169931_105470921 | 3300017788 | Freshwater | NMTDFSKYKNITVDNQTYAIVTKLQTRLKRDVKLSRSQVVKTLVKEKARNLNGSLK |
| Ga0169931_107726203 | 3300017788 | Freshwater | MTDFSKYKNITVDNQTYAIVTKLQTRLKRDVKLSRSQVV |
| Ga0181577_109379381 | 3300017951 | Salt Marsh | MTDFNKYKNITVDNETYDNVTKLQTAMVPDMKISRSAVVKS |
| Ga0180433_100926816 | 3300018080 | Hypersaline Lake Sediment | MTDFSKYKNITVDKECYAVITKLQTKLKEDVKLSRSQVVKTLVTEKARRLNGKLDKK |
| Ga0181592_108285893 | 3300018421 | Salt Marsh | MKGKRMTDFSKYKNITVDNATYETITKLQTKLATDVKLS |
| Ga0181359_12326523 | 3300019784 | Freshwater Lake | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSRSQVIKTLV |
| Ga0194110_108369423 | 3300020084 | Freshwater Lake | MTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGKLTK |
| Ga0211735_100465362 | 3300020162 | Freshwater | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSRSQVIK |
| Ga0194134_100074697 | 3300020179 | Freshwater Lake | MTDFNKYKNITVDNDTYAIVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0211731_112769653 | 3300020205 | Freshwater | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSRSQVIKTLVNE |
| Ga0181570_103282993 | 3300020207 | Salt Marsh | MTDFSKYKNITVDNATYETITKLQTKLATDVKLSRSQ |
| Ga0211707_10252431 | 3300020246 | Marine | MTDFSKYKNITVDNDTYAIITKLQTQIAPDVKLSRSQVVKTLAKEKAKKL |
| Ga0211677_1001254211 | 3300020385 | Marine | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRSQV |
| Ga0208600_10101835 | 3300020550 | Freshwater | MTDFSKYKNITVDNDTYAIVTKLQTKLKNDVKLSRS |
| Ga0208855_10103581 | 3300020553 | Freshwater | MTDFSKYKNITVDNDTYAIVTKLQTKLKSDVKLSRS |
| Ga0194133_105411491 | 3300021091 | Freshwater Lake | MTDFNKYKNITVDNETYSVVTKLQTKLKKDVKLSRSQVVKTLVKEKARK |
| Ga0213864_102628545 | 3300021379 | Seawater | MTDYTKYKNVTVDNKTYDTITKMQTKLKSDVKLSRS |
| Ga0222716_103859984 | 3300021959 | Estuarine Water | MTDFSKYKNITVDKDTYGTITKMQTKLADNVKLSR |
| Ga0222714_101456485 | 3300021961 | Estuarine Water | SKYSNVTVDNQTYAIITKLQTKLVPEVTLSRSQVIKTIVQEKAKTLNGRLK |
| Ga0222714_101720816 | 3300021961 | Estuarine Water | MTDFSKYKNITVDNDTYAVVTKLQTKMTPDVKLSRS |
| Ga0222713_107922511 | 3300021962 | Estuarine Water | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSRSQVIKTLVNEK |
| Ga0212029_10148265 | 3300022063 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVKTLVQE |
| Ga0212024_10983623 | 3300022065 | Aqueous | MTDFSKYKNVTVDNDTYATITKMQTKLKKDIKLSRSQVVK |
| Ga0212020_10873183 | 3300022167 | Aqueous | MTDFSKYKNVTVDNDTYSIITKLQTKLKDDVKLSR |
| Ga0196891_10756572 | 3300022183 | Aqueous | MTDFTRYKNVTVDKKTYETITKMQTKLTPDTKLSRSQVVT |
| Ga0181354_12291292 | 3300022190 | Freshwater Lake | MTDFSKYKNITVDNDTYAIVTKLQTKLKSDVKLSRSQVIKTLVN |
| Ga0196905_11318221 | 3300022198 | Aqueous | MTDFSKYKNITVDNETYATVTRLQTKMTPDVKLSRSQVIKTLVKE |
| Ga0196901_10715986 | 3300022200 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVKTL |
| Ga0255762_103012694 | 3300023119 | Salt Marsh | MKGKRMTDFSKYKNITVDNATYETITKLQTKLATDV |
| Ga0255761_104044524 | 3300023170 | Salt Marsh | MTDFSKYKNITVDNETYATVTRLQTKMTPDVKLSRSQVIKTLVK |
| Ga0208919_10537571 | 3300025128 | Marine | MTDFSKYKNITVDNDTYATITKLQTKIAPDVKLSRSQ |
| Ga0209645_10841201 | 3300025151 | Marine | MTDFSKYKNITVDNDTYATITKLQTKLAPDVKLSRSQVVKT |
| Ga0208814_11308293 | 3300025276 | Deep Ocean | MKERLYKMTDFSKYKNITVDNNTYATITKLQTKIA |
| Ga0208181_10757841 | 3300025300 | Deep Ocean | MTDYNKYKNVTVDNKTYDTITKMQTKLTPDTKLSRSQVVT |
| Ga0208161_10796431 | 3300025646 | Aqueous | MTDKSKYSNVTVDNKTYEIITKLQTKLVPDMKISRSQVIKQI |
| Ga0208162_10810125 | 3300025674 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRS |
| Ga0208019_11115094 | 3300025687 | Aqueous | MTDFSKYKNITVDKDTYATITRMQTKLADNVKLSRSQVVKT |
| Ga0208767_10064861 | 3300025769 | Aqueous | MTDFSKYKNVTVDNDTYTTITKLQTKLKDDVKLSRSK |
| Ga0209714_11794293 | 3300025822 | Pelagic Marine | MTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRSQVV |
| Ga0208547_11500221 | 3300025828 | Aqueous | MTDKSKYSNVTVDNKTYEIITRLQTKLIPDMKISRSQ |
| Ga0208644_11330946 | 3300025889 | Aqueous | MTDFSKYKNITVDNETYATVTRLQTKMTPDVKLSRSQVIKTLVKEK |
| Ga0208916_104063763 | 3300025896 | Aqueous | MTDFSKYKNVTVDNDTYAKLTKLQTKMVNDDLKLSRSQIVK |
| Ga0208966_10721694 | 3300027586 | Freshwater Lentic | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDIKLSR |
| (restricted) Ga0247836_10309982 | 3300027728 | Freshwater | MTDFNKYKNITVDNDTYATVTKLQTKLKRDIKLSRSQVIKTLVKEKARLLNGSLTK |
| (restricted) Ga0247836_10926592 | 3300027728 | Freshwater | MTDFNKYKNITVDNDTYTTVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLSK |
| (restricted) Ga0247836_11792193 | 3300027728 | Freshwater | MTDFNKYKNITVDNDTYSTVTKLQTKLKRDVKLSRSQVIKTLVKEKARLLNGSLTK |
| Ga0209598_102714991 | 3300027760 | Freshwater Lake | MTDFSKYKNITVDNDTYGLVTRLQTKLKRDVKLSRSQVIKT |
| Ga0209134_101036924 | 3300027764 | Freshwater Lake | MTDFSKYKNITVDNDTYAIVTKLQTKLKNDIKLSRSQVIKTLVNEK |
| Ga0209536_1011797001 | 3300027917 | Marine Sediment | MTDFTKYKNVTVDNKTYDVITKMQTKLTPDIKLSRSQ |
| Ga0257127_11653283 | 3300028189 | Marine | IGKNIITERLYKMTDFSKYKNITVDKETYSTITKLQTKIAPDVKLSRSQVVKTLVNEKARKLNGRLSK |
| (restricted) Ga0247843_11453073 | 3300028569 | Freshwater | MTDFNKYKNITVDNDTYSTVTKLQTKLKRDVKLSRSQVIKTLVKEKARL |
| Ga0307376_102985181 | 3300031578 | Soil | MTDKSKYSNVTVDNQTYAIITKLQTKLVPEVTLSR |
| Ga0307376_106542553 | 3300031578 | Soil | MTDKSKYSNITVDNKTYDIITKLQMKLIPEMKISRSQVVKQ |
| Ga0307375_101984025 | 3300031669 | Soil | MTDKSKYSNITVDNKTYDIITKLQMKLIPKMKISRSQV |
| Ga0315284_105504091 | 3300032053 | Sediment | MTDFSKYKNITVDNDTYGLVTKLQTKLKRDVKLSR |
| Ga0315902_112746191 | 3300032093 | Freshwater | MTDFSKYKNITVDNDTYAIVTKLQTKLKKDIKLSRSQ |
| Ga0334996_0504577_1_120 | 3300033994 | Freshwater | MTDFSKYKNITVDNDTYAIVTKLQTKLKKDIKLSRSQVIK |
| Ga0334985_0209357_2_106 | 3300034018 | Freshwater | MTDFSKYKNITVDNDTYAIVTKLQTKLKNDVKLSR |
| Ga0348336_082781_1_108 | 3300034375 | Aqueous | MTDFSKYKNITVDKDTYGTITKMQTKLADNVKLSRS |
| ⦗Top⦘ |