


| Basic Information | |
|---|---|
| Family ID | F095095 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSESEQPSRIETFLYDADGNRTEDESVAVRGEVVELDAAGRVIARHA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.33 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 83.81 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (29.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.048 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.00% Coil/Unstructured: 68.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01545 | Cation_efflux | 11.43 |
| PF12695 | Abhydrolase_5 | 5.71 |
| PF00232 | Glyco_hydro_1 | 4.76 |
| PF13091 | PLDc_2 | 2.86 |
| PF13522 | GATase_6 | 2.86 |
| PF06772 | LtrA | 2.86 |
| PF13456 | RVT_3 | 1.90 |
| PF08352 | oligo_HPY | 1.90 |
| PF12850 | Metallophos_2 | 1.90 |
| PF00857 | Isochorismatase | 0.95 |
| PF03109 | ABC1 | 0.95 |
| PF04545 | Sigma70_r4 | 0.95 |
| PF03358 | FMN_red | 0.95 |
| PF00582 | Usp | 0.95 |
| PF07452 | CHRD | 0.95 |
| PF06480 | FtsH_ext | 0.95 |
| PF00571 | CBS | 0.95 |
| PF13602 | ADH_zinc_N_2 | 0.95 |
| PF00156 | Pribosyltran | 0.95 |
| PF00027 | cNMP_binding | 0.95 |
| PF02036 | SCP2 | 0.95 |
| PF03729 | DUF308 | 0.95 |
| PF09985 | Glucodextran_C | 0.95 |
| PF13515 | FUSC_2 | 0.95 |
| PF12706 | Lactamase_B_2 | 0.95 |
| PF00528 | BPD_transp_1 | 0.95 |
| PF05988 | DUF899 | 0.95 |
| PF13460 | NAD_binding_10 | 0.95 |
| PF13632 | Glyco_trans_2_3 | 0.95 |
| PF01625 | PMSR | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| PF12697 | Abhydrolase_6 | 0.95 |
| PF11189 | DUF2973 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 11.43 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 11.43 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 11.43 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 4.76 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 2.86 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.95 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.95 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.95 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.24 % |
| Unclassified | root | N/A | 4.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100859101 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300001305|C688J14111_10003895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4087 | Open in IMG/M |
| 3300004081|Ga0063454_100426263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
| 3300004114|Ga0062593_100804769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300004156|Ga0062589_100294878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1249 | Open in IMG/M |
| 3300004480|Ga0062592_100385844 | Not Available | 1107 | Open in IMG/M |
| 3300005093|Ga0062594_100617696 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005163|Ga0066823_10060339 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005187|Ga0066675_10107829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1850 | Open in IMG/M |
| 3300005332|Ga0066388_102965865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300005364|Ga0070673_100417907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
| 3300005438|Ga0070701_10014466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3619 | Open in IMG/M |
| 3300005440|Ga0070705_101949334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300005441|Ga0070700_100012648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4718 | Open in IMG/M |
| 3300005540|Ga0066697_10577063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300005545|Ga0070695_100758291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300005546|Ga0070696_100205589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1472 | Open in IMG/M |
| 3300005553|Ga0066695_10168075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1370 | Open in IMG/M |
| 3300005841|Ga0068863_100372356 | Not Available | 1394 | Open in IMG/M |
| 3300006034|Ga0066656_10481495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 809 | Open in IMG/M |
| 3300006845|Ga0075421_100205342 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300006871|Ga0075434_101275811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300006914|Ga0075436_101250582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300009012|Ga0066710_100848444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1403 | Open in IMG/M |
| 3300009090|Ga0099827_11351488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300009137|Ga0066709_104274322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300009156|Ga0111538_10553808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1458 | Open in IMG/M |
| 3300009162|Ga0075423_10592925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300009162|Ga0075423_11664088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300010329|Ga0134111_10246743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
| 3300010400|Ga0134122_12935425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300010401|Ga0134121_11142896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300010999|Ga0138505_100022897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300011119|Ga0105246_10064924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2552 | Open in IMG/M |
| 3300012011|Ga0120152_1071999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
| 3300012198|Ga0137364_10561383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300012201|Ga0137365_11137204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300012285|Ga0137370_10951963 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012354|Ga0137366_10416822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300012356|Ga0137371_10835306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300012357|Ga0137384_11412934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300012361|Ga0137360_10093000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
| 3300012914|Ga0157297_10159597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300012915|Ga0157302_10176400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300012930|Ga0137407_11078991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300012955|Ga0164298_10594113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300012957|Ga0164303_10857821 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012976|Ga0134076_10511711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300012985|Ga0164308_10846478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300015077|Ga0173483_10689438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300015357|Ga0134072_10330539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300015358|Ga0134089_10520532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300015359|Ga0134085_10378508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300015371|Ga0132258_13561805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1065 | Open in IMG/M |
| 3300017657|Ga0134074_1141636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300018027|Ga0184605_10450646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300018028|Ga0184608_10417160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300018061|Ga0184619_10520848 | Not Available | 523 | Open in IMG/M |
| 3300019869|Ga0193705_1049916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300021080|Ga0210382_10381573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300024275|Ga0247674_1028715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300024317|Ga0247660_1002497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2573 | Open in IMG/M |
| 3300025898|Ga0207692_10297437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
| 3300025901|Ga0207688_10033261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2851 | Open in IMG/M |
| 3300025906|Ga0207699_10462291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 912 | Open in IMG/M |
| 3300025928|Ga0207700_10347344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1291 | Open in IMG/M |
| 3300025931|Ga0207644_10668886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300025934|Ga0207686_10485461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300025972|Ga0207668_10745408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300026142|Ga0207698_10077211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2670 | Open in IMG/M |
| 3300026547|Ga0209156_10244746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300027846|Ga0209180_10481576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300027907|Ga0207428_10045522 | All Organisms → cellular organisms → Bacteria | 3533 | Open in IMG/M |
| 3300028047|Ga0209526_10772165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300028379|Ga0268266_10540257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
| 3300028707|Ga0307291_1032055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
| 3300028709|Ga0307279_10083270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300028711|Ga0307293_10021048 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300028715|Ga0307313_10056304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1158 | Open in IMG/M |
| 3300028716|Ga0307311_10016986 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300028716|Ga0307311_10030141 | Not Available | 1391 | Open in IMG/M |
| 3300028718|Ga0307307_10003290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4073 | Open in IMG/M |
| 3300028720|Ga0307317_10277511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300028721|Ga0307315_10019971 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300028755|Ga0307316_10156244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300028784|Ga0307282_10020830 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300028784|Ga0307282_10561171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300028787|Ga0307323_10178842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300028811|Ga0307292_10247502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300028814|Ga0307302_10201876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300028824|Ga0307310_10023788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2423 | Open in IMG/M |
| 3300028828|Ga0307312_10026501 | All Organisms → cellular organisms → Bacteria | 3348 | Open in IMG/M |
| 3300028828|Ga0307312_10035650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2918 | Open in IMG/M |
| 3300028828|Ga0307312_10424562 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300028876|Ga0307286_10086495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
| 3300028881|Ga0307277_10170689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300028884|Ga0307308_10000637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12906 | Open in IMG/M |
| 3300028884|Ga0307308_10029103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2562 | Open in IMG/M |
| 3300031421|Ga0308194_10065066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300031908|Ga0310900_10900394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300031908|Ga0310900_11514127 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300032180|Ga0307471_101786446 | Not Available | 767 | Open in IMG/M |
| 3300033550|Ga0247829_10476733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300034820|Ga0373959_0140068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300034820|Ga0373959_0194693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 29.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1008591013 | 3300000956 | Soil | VNDTPNRIETVLYDADGNRTDDEALAVRAETVELDADGNVV |
| C688J14111_100038951 | 3300001305 | Soil | MSFLSDSEQPTRIETFLYDADGNRTEEESIAVRGEVVELDADGRVTARHEHLDWAVXX |
| Ga0063454_1004262632 | 3300004081 | Soil | MSFLSDSEQPTRIETFLYDADGNRTEEESIAVRGEVVELD |
| Ga0062593_1008047692 | 3300004114 | Soil | MPEARIETFLYDADGNRTDDEALAVRAETVEVDAEGNVVA |
| Ga0062589_1002948781 | 3300004156 | Soil | MSDRSQPSRIETFLYDADGNRTKDESLAVRGEIVELDASGRVLARRPHD |
| Ga0062592_1003858442 | 3300004480 | Soil | VSDSGPPTRIETILYDADGNRTQEESIAVRGEVVELDGEGRVLARHEHL |
| Ga0062594_1006176961 | 3300005093 | Soil | MTEQPTRIETFLYDADGNRTEEESMAVRGEVVELDADGRVIARHEHLDWEVDPISLEGD |
| Ga0066823_100603391 | 3300005163 | Soil | MTEQPSRIETFLYDADGNRTKEESIAVRGEVVELDADGRVIARHEHLDWEVDPISLEG |
| Ga0066675_101078291 | 3300005187 | Soil | MSEGGQPSRIETFLYDADGNRTEDESLAVRSETVELDADGHVLETRAHEGLDWQVDP |
| Ga0066388_1029658651 | 3300005332 | Tropical Forest Soil | MSERGEPSRIETFLYDADGNRTEDESVAVRGEIVELDAAGRVLSRRPHD |
| Ga0070673_1004179071 | 3300005364 | Switchgrass Rhizosphere | MSERPTRIETVLYDADGNRTDDESVAVRGEVVEVDDAGRVIARHPQ |
| Ga0070701_100144665 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAAGRV |
| Ga0070705_1019493342 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MCAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAD |
| Ga0070700_1000126486 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAAGRVIARHEHLDWEVDPISLE |
| Ga0066697_105770632 | 3300005540 | Soil | MSEGSQPSRIETFLYDADGNRTEDESVAVRGETVELDAEGRVLARRTHEGLDWQ |
| Ga0070695_1007582912 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPRTETILYDADGNRTDDESVAVRGEVVEVDDAGRVVARHQDLDWEVDPISL |
| Ga0070696_1002055893 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEGRIETFLYDADGNRTDDESLAVRAELVELDAEGRVIGRR |
| Ga0066695_101680751 | 3300005553 | Soil | MSDSEQPNRIETVLYDADGNRTQEESIAVRGEVIELDAEGRVIARHEHL |
| Ga0068863_1003723561 | 3300005841 | Switchgrass Rhizosphere | MAEPRTETILYDADGNRTDDESVAVRGEVVEVDDAGRV |
| Ga0066656_104814952 | 3300006034 | Soil | MSEGQSNRIETILYDADGNRTDDESVAVRGEVVEIDAAGRVVARRPQEGLDWKVDPKSLE |
| Ga0075421_1002053424 | 3300006845 | Populus Rhizosphere | MPEARIETFLYDADGNRTDDEASAVRAETVEVDAQG |
| Ga0075434_1012758111 | 3300006871 | Populus Rhizosphere | MSQGEQPNRIQTFLYDAHGNRTEDESSAVRGEIVELDAEGRV |
| Ga0075436_1012505822 | 3300006914 | Populus Rhizosphere | MPEARIETFLYDADGNRTDDEAAAVRAETVELDADGN |
| Ga0066710_1008484441 | 3300009012 | Grasslands Soil | MSESEQPSRIETFLYDADGNRTEDESVAVRGEVVELDA |
| Ga0099827_113514883 | 3300009090 | Vadose Zone Soil | MSDGEQAANRIETFLYDAEGNRTEDESVAVRGEVVELDAEGRVIAGHTHDDL |
| Ga0066709_1042743222 | 3300009137 | Grasslands Soil | MSESEQPNRIETFLYDADGNRTDDESVAVRGEVVELD |
| Ga0111538_105538083 | 3300009156 | Populus Rhizosphere | MSESSQPSRIETFLYDADGNRTKDESLAVRGEIVELDA |
| Ga0075423_105929253 | 3300009162 | Populus Rhizosphere | MGCAMSQGEQRNRIETFLYDAHGNRTEDESSAVRGEIVELDAEGRVI |
| Ga0075423_116640881 | 3300009162 | Populus Rhizosphere | VSGLSGTIAFMTTRIETILYDADGNRTDDEASAVRAETVEVDAQGNVVARRAHDSLGWEVDPISLE |
| Ga0134111_102467431 | 3300010329 | Grasslands Soil | MSEGQSNRIETILYDADGNRTDDESVAVRGEVVEIDAAGRVVARRPQEGL |
| Ga0134122_129354252 | 3300010400 | Terrestrial Soil | MSERPTRIETVLYDADGNRTDDESLAVRGEVVEVDDAGRVVARHP |
| Ga0134121_111428961 | 3300010401 | Terrestrial Soil | VPARAADTRLETILYDADGNRTDDESVAVRGEVVEVDDAGRVVARHPDLDWEVDPISLEG |
| Ga0138505_1000228972 | 3300010999 | Soil | MSDGEQVSRIETFLYDADGNRTEDEGLAVRGEVVELDAEGRVI |
| Ga0105246_100649241 | 3300011119 | Miscanthus Rhizosphere | MTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAAGRVIARHEHL |
| Ga0120152_10719992 | 3300012011 | Permafrost | MSGGEQTSRIETFLYDADGNRTEEESIAVRGEVVELDAEGRVIARHEHLGWEVD |
| Ga0137364_105613833 | 3300012198 | Vadose Zone Soil | MSESQQPNRIETFLYDADGNRTDDESIAVRGEVVELDAEGRVIATHAHDGLGWEVDPISLKAIRA |
| Ga0137365_111372043 | 3300012201 | Vadose Zone Soil | MSESEPRRIETFLYDAEGNRTDDDALAVRGETVELDAD |
| Ga0137370_109519632 | 3300012285 | Vadose Zone Soil | MSESGQPSRIETRLYDADGNLTSDESIAVRGEVVELDGESRVIARHEQGGLAWQV |
| Ga0137366_104168221 | 3300012354 | Vadose Zone Soil | MSEREQPSGIETFLYDADGNRTEDESVAVRGEVVELD |
| Ga0137371_108353062 | 3300012356 | Vadose Zone Soil | MSESEQPGRIETFLYDADGNRTEDESVAVRGEVVELDAAGRVIARHAHDGLGWEVDP |
| Ga0137384_114129342 | 3300012357 | Vadose Zone Soil | MSESDQRSRIETFLYDAEGNRTNDDALAVRGETVELDADGRVIAR |
| Ga0137360_100930001 | 3300012361 | Vadose Zone Soil | MSESEQPNRIETFLYDADGNRTDDESVAVRGEVVELDAEGHVIATHVHD |
| Ga0157297_101595972 | 3300012914 | Soil | MSESGHANKIETILYDADGNRTQEESIAVRAEVVELD |
| Ga0157302_101764001 | 3300012915 | Soil | MSEGDRPTRIETVLFDADGNRTDDESVAVRGEIVELD |
| Ga0137407_110789911 | 3300012930 | Vadose Zone Soil | MSESEQPSRIETFLYDADGNRTEDESVAVRGEVVELDAAGRVIARHA |
| Ga0164298_105941131 | 3300012955 | Soil | VSDSGQPNRIETFLYDADGNRTEEESIAVRAEVVELDAEGRVIARHEQLDWEV |
| Ga0164303_108578211 | 3300012957 | Soil | MSKSGQPTRVETRMYDADGNLTEDESLAVRGEVVELDAAGRVIARHRHDG |
| Ga0134076_105117112 | 3300012976 | Grasslands Soil | MSESEQPGRIETFLYDADGNRTEDESVAVRGEVVELDAAGRVIARH |
| Ga0164308_108464781 | 3300012985 | Soil | VSEQPSRIETFLYDADGNRTDEESIAVRGEVVELD |
| Ga0173483_106894381 | 3300015077 | Soil | LSDSGQPNRIETILYDADGNRTDDESVAVRGEVVDVDDARRVVGRH |
| Ga0134072_103305391 | 3300015357 | Grasslands Soil | MSEGGQPSRIETFLYDADGNRTEDESLAVRSETVELDADGHVLETRAHEGLDWQVDPK |
| Ga0134089_105205321 | 3300015358 | Grasslands Soil | MSDGEQPSRLETVLYDANGNRTDDESIAVRGEVVELDASGRV |
| Ga0134085_103785082 | 3300015359 | Grasslands Soil | MSEGQSNRIETILYDADGNRTEDESLAVRGETVELDAEGRVLARRTHEGLDWQV |
| Ga0132258_135618051 | 3300015371 | Arabidopsis Rhizosphere | MSERPTRMETVLYDADGNRTDDESIAVRGELVELDAEGRVLARHPH |
| Ga0134074_11416361 | 3300017657 | Grasslands Soil | MSESEQPGRIETFLYDADGNRTEDESVAVRGEVVELDAAGRVI |
| Ga0184605_104506461 | 3300018027 | Groundwater Sediment | MSDGEQVSRIETFLYDADGNRTEDEGIAVRGEVVELD |
| Ga0184608_104171602 | 3300018028 | Groundwater Sediment | MSESDQPSRIETFLYDADGHRTDDESVAVRGEVVELDA |
| Ga0184619_105208481 | 3300018061 | Groundwater Sediment | MSQGEQPSRIETFLYDANGNRTEDESVAVRGEVVE |
| Ga0193705_10499161 | 3300019869 | Soil | MSEGGEPTRIETFLYDADGNRTEDENVAVRGEIVE |
| Ga0210382_103815731 | 3300021080 | Groundwater Sediment | MSDSEQPSRVETFLYDADGNRTEDEAVAVRGEVVELDAEGRVIARHQHLD |
| Ga0247674_10287151 | 3300024275 | Soil | MSERPTRIETVLYDADGNRTDDESVAVRGEIVELDAEGRVVARRPHDGLDWKV |
| Ga0247660_10024971 | 3300024317 | Soil | MSERPTRIETVLYDADGNRTDDESVAVRGEIVELDAEGRVVARRPH |
| Ga0207692_102974371 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERPTRMETVLYDADGNRTDDESVAVRGELVELDAEGR |
| Ga0207688_100332611 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDA |
| Ga0207699_104622912 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERPTRMETVLYDADGNRTDDESIAVRGELVELDAEGRVVARHPHDGLDWKVDPKSLEG |
| Ga0207700_103473441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERPTRIETVLYDADGNRTDDESVAVRGEIVELDAEGRVVARRPHDGLDWKVD |
| Ga0207644_106688862 | 3300025931 | Switchgrass Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDADGRVIARHEHLD |
| Ga0207686_104854612 | 3300025934 | Miscanthus Rhizosphere | MAEPRTETILYDADGNRTDDESVAVRGEVVEVDDAGRVVARHPDLDWE |
| Ga0207668_107454082 | 3300025972 | Switchgrass Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAAGRVIARHEHLD |
| Ga0207698_100772111 | 3300026142 | Corn Rhizosphere | MWAMTEQPSRIETFLYDADGNRTEEESIAVRGEVVELDAAGRVIARHEHLDWEVDPIS |
| Ga0209156_102447462 | 3300026547 | Soil | MSDGEQPSRLETVLYDANGNRTDDESVAVRGEVVELDATGRVIARHAHDGLGWEVDPISL |
| Ga0209180_104815761 | 3300027846 | Vadose Zone Soil | MSESEQPNRIETFLYDADGNRTDDESVAVRGEVVELDAEGRVIATH |
| Ga0207428_100455226 | 3300027907 | Populus Rhizosphere | MGEGSQASRIETVLYDTEGNRTEDESLAVRGEVVELDEAGRVLARRPHEGLDWEVDPKS |
| Ga0209526_107721651 | 3300028047 | Forest Soil | MTESKQPSRIETFLYDADGNRTEEESVAVRGEVVELDAEGRVISRHAHDDL |
| Ga0268266_105402574 | 3300028379 | Switchgrass Rhizosphere | MAEPRTETILYDADGNRTDDESVAVRGEVVEVDDAGRVVARHPDLDWEVDPI |
| Ga0307291_10320551 | 3300028707 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGLAVRGEVVELDAEGRVIATHEH |
| Ga0307279_100832701 | 3300028709 | Soil | MSDSGQPNKIETILYDADGNRTQEESIAVRGEVVELDAEGRVIARHEQLDWKVDPISLEG |
| Ga0307293_100210481 | 3300028711 | Soil | MSEQPTRIETFLYDADGNRTEEESIAVRGEVVELDG |
| Ga0307313_100563043 | 3300028715 | Soil | MLNRGASNSDREQPSRIETFLYDADGNRTEEESIAAPGEVVELDAEGRVIARHAHDELGCEV |
| Ga0307311_100169861 | 3300028716 | Soil | VSDSEQPRRIETFLYDADGNRTEEESIAVRGEVVELDADGRVIARHEHLDWEVDPIS |
| Ga0307311_100301412 | 3300028716 | Soil | MSDSGQPNKIETILYDADGNRTQEESIAVRGEVVELDAEGHIIARHEQLD |
| Ga0307307_100032901 | 3300028718 | Soil | MSEQPTRIETFLYDADGNRTEEESIAVRGEVVELDGDGRVI |
| Ga0307317_102775112 | 3300028720 | Soil | MSDSGQPNKIETILYDADGNRTQEESIAVRGEVVELDAEGR |
| Ga0307315_100199713 | 3300028721 | Soil | MSEQPTRIETFLYDADGNRTEEESIAVRGEVVELD |
| Ga0307316_101562443 | 3300028755 | Soil | MSDSEQPHRVETVLYDADGNRTQEESIAVRGEVVEL |
| Ga0307282_100208305 | 3300028784 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGIAVRGEVVEL |
| Ga0307282_105611711 | 3300028784 | Soil | MSENEQPSRIETFLYDADGNRTEDESVAVRGEVVELDAAGR |
| Ga0307323_101788421 | 3300028787 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGLAVRGEVVELDAEGRVIATHEHDG |
| Ga0307292_102475021 | 3300028811 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGIAVRGEVVELDAEGRVVATHEHDGLSWKVDPISL |
| Ga0307302_102018761 | 3300028814 | Soil | VSDSEQPRRIETFLYDADGNRTEEESIAVRGEVVELDGDGRVIARHEHLDWEVDPISLEG |
| Ga0307310_100237881 | 3300028824 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGIAVRGEVVELDAEGRVVATHEHDGLSWKVDPI |
| Ga0307312_100265011 | 3300028828 | Soil | MSEQPTRIETFLYDADGNRTEEESIAVRGEVVELDGDGRVIARHEHLDWEVD |
| Ga0307312_100356501 | 3300028828 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGIAVRGEVVELDAEGRVVATHEHDGLSWK |
| Ga0307312_104245621 | 3300028828 | Soil | MSDGEQVSRIETFLYDADGNRTEDEGIAVRGEVVELDAEGRVIATHAHDGLSWK |
| Ga0307286_100864951 | 3300028876 | Soil | VSDSEQPRRIETFLYDADGNRTEEESIAVRGEVVELDGDG |
| Ga0307277_101706892 | 3300028881 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGLAVRGEVVELDAEGPRHCDA |
| Ga0307308_1000063713 | 3300028884 | Soil | MSEQPTRIETFLYDADGNRTEEESIAVRGEVVELDGDGRVIARHEHLDWEVDPI |
| Ga0307308_100291031 | 3300028884 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGIAVRGEVVELDAEGPRRCDA |
| Ga0308194_100650662 | 3300031421 | Soil | MSDSEQVSRIETFLYDADGNRTEDEGLAVRGEVVELD |
| Ga0310900_109003941 | 3300031908 | Soil | MSERPTRIETVLYDADGNRTDDESVAVRGEIVELDAEGRV |
| Ga0310900_115141272 | 3300031908 | Soil | MEGAMSEGSQPSRIETFLYDADGNRTDDESLAVRGE |
| Ga0307471_1017864462 | 3300032180 | Hardwood Forest Soil | MSEGGRPHRIETILYDAGGNRTEDESLAVRGEVVEVDAEGRIVSRRPYA |
| Ga0247829_104767331 | 3300033550 | Soil | MSEGDEPSRIETVLYDADGNRTEDENVAVRGEIVELDAAGRVLARRPHDGLDWQV |
| Ga0373959_0140068_1_159 | 3300034820 | Rhizosphere Soil | MSERPTRIETVLYDADGNRTDDESVAVRGEIVELDAEGRVVTRRPHDGLDWKV |
| Ga0373959_0194693_354_533 | 3300034820 | Rhizosphere Soil | MTEQRTRIETFLYDADGNRTEDENVAVRGEIVELDAAGRVLARRPHDGLDWQVDPKSLEG |
| ⦗Top⦘ |