


| Basic Information | |
|---|---|
| Family ID | F095027 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLTPRKKRPHRVKLVTDPVTGLPALSAGPSAPTLSSKEVEEILANFP |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.52 % |
| % of genes near scaffold ends (potentially truncated) | 89.52 % |
| % of genes from short scaffolds (< 2000 bps) | 80.95 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.00% β-sheet: 10.67% Coil/Unstructured: 77.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 6.67 |
| PF00892 | EamA | 2.86 |
| PF02604 | PhdYeFM_antitox | 1.90 |
| PF00665 | rve | 1.90 |
| PF01797 | Y1_Tnp | 1.90 |
| PF13470 | PIN_3 | 0.95 |
| PF13564 | DoxX_2 | 0.95 |
| PF00478 | IMPDH | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF08544 | GHMP_kinases_C | 0.95 |
| PF00534 | Glycos_transf_1 | 0.95 |
| PF08281 | Sigma70_r4_2 | 0.95 |
| PF04055 | Radical_SAM | 0.95 |
| PF14066 | DUF4256 | 0.95 |
| PF01402 | RHH_1 | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF15780 | ASH | 0.95 |
| PF03447 | NAD_binding_3 | 0.95 |
| PF13551 | HTH_29 | 0.95 |
| PF12161 | HsdM_N | 0.95 |
| PF13231 | PMT_2 | 0.95 |
| PF04014 | MazE_antitoxin | 0.95 |
| PF08530 | PepX_C | 0.95 |
| PF13185 | GAF_2 | 0.95 |
| PF13473 | Cupredoxin_1 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.90 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.90 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.90 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.90 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.90 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.90 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.90 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_103655966 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300001546|JGI12659J15293_10107269 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004092|Ga0062389_100990254 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300004121|Ga0058882_1504699 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300004635|Ga0062388_100696084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 948 | Open in IMG/M |
| 3300004635|Ga0062388_102536255 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005434|Ga0070709_10674159 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005437|Ga0070710_10632214 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005591|Ga0070761_10060631 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300005614|Ga0068856_100399899 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300005718|Ga0068866_10052885 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300005764|Ga0066903_109159768 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005842|Ga0068858_102302219 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006893|Ga0073928_10824955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300006914|Ga0075436_101337200 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009624|Ga0116105_1000280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14643 | Open in IMG/M |
| 3300009628|Ga0116125_1013010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2100 | Open in IMG/M |
| 3300009683|Ga0116224_10042049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2237 | Open in IMG/M |
| 3300009709|Ga0116227_10621280 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300009759|Ga0116101_1021845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1260 | Open in IMG/M |
| 3300009764|Ga0116134_1058012 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300010159|Ga0099796_10099950 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300010343|Ga0074044_10713052 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010343|Ga0074044_11132358 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010361|Ga0126378_13048581 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010376|Ga0126381_104778125 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010379|Ga0136449_100084574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6659 | Open in IMG/M |
| 3300012203|Ga0137399_11262977 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012207|Ga0137381_11508833 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012208|Ga0137376_10738763 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012209|Ga0137379_11547880 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012351|Ga0137386_10545791 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012355|Ga0137369_10107006 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300012363|Ga0137390_10907931 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012532|Ga0137373_10421409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300012582|Ga0137358_10017756 | All Organisms → cellular organisms → Bacteria | 4541 | Open in IMG/M |
| 3300012917|Ga0137395_10409430 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300012960|Ga0164301_10522944 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300014159|Ga0181530_10448362 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300014489|Ga0182018_10003171 | All Organisms → cellular organisms → Bacteria | 15165 | Open in IMG/M |
| 3300014493|Ga0182016_10248952 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300014495|Ga0182015_10879869 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300014655|Ga0181516_10245859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300015053|Ga0137405_1000945 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300016371|Ga0182034_11277904 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300016387|Ga0182040_10031460 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
| 3300017823|Ga0187818_10176193 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300017933|Ga0187801_10074250 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300017941|Ga0187850_10188214 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300017946|Ga0187879_10641615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 590 | Open in IMG/M |
| 3300017948|Ga0187847_10020480 | All Organisms → cellular organisms → Bacteria | 4091 | Open in IMG/M |
| 3300017995|Ga0187816_10029573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2212 | Open in IMG/M |
| 3300018003|Ga0187876_1164085 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018006|Ga0187804_10310643 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018012|Ga0187810_10319787 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018035|Ga0187875_10374395 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300018037|Ga0187883_10675485 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300018038|Ga0187855_10468099 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300018038|Ga0187855_10880682 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300018047|Ga0187859_10120008 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300018057|Ga0187858_10216081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1244 | Open in IMG/M |
| 3300020581|Ga0210399_10043561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3597 | Open in IMG/M |
| 3300020581|Ga0210399_10416427 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300020581|Ga0210399_10521030 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300021181|Ga0210388_10125662 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300021405|Ga0210387_10242043 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300021445|Ga0182009_10060948 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300021478|Ga0210402_11661989 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300022531|Ga0242660_1231792 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300022532|Ga0242655_10254782 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025496|Ga0208191_1000020 | All Organisms → cellular organisms → Bacteria | 166006 | Open in IMG/M |
| 3300025588|Ga0208586_1137455 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025898|Ga0207692_10873021 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025906|Ga0207699_10980393 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300026343|Ga0209159_1202099 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300026552|Ga0209577_10841168 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027432|Ga0209421_1128894 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027645|Ga0209117_1001529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8206 | Open in IMG/M |
| 3300027696|Ga0208696_1143211 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300027824|Ga0209040_10087700 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300027895|Ga0209624_10511370 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027895|Ga0209624_10790145 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027905|Ga0209415_10177109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2070 | Open in IMG/M |
| 3300027911|Ga0209698_10048194 | All Organisms → cellular organisms → Bacteria | 3754 | Open in IMG/M |
| 3300028015|Ga0265353_1006931 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300028759|Ga0302224_10162967 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300028792|Ga0307504_10306544 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300028866|Ga0302278_10226960 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300029907|Ga0311329_10913566 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300029943|Ga0311340_10225542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300029955|Ga0311342_10223911 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300030007|Ga0311338_11219795 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300030053|Ga0302177_10403531 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300030058|Ga0302179_10000595 | All Organisms → cellular organisms → Bacteria | 23599 | Open in IMG/M |
| 3300030580|Ga0311355_10852816 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300030707|Ga0310038_10398880 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031446|Ga0170820_14878354 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031544|Ga0318534_10569994 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031708|Ga0310686_111872349 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300031910|Ga0306923_10282410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1898 | Open in IMG/M |
| 3300031962|Ga0307479_11603079 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032783|Ga0335079_11755014 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300032805|Ga0335078_11275118 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300033402|Ga0326728_10016260 | All Organisms → cellular organisms → Bacteria | 15224 | Open in IMG/M |
| 3300034163|Ga0370515_0124944 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.90% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.95% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.95% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1036559663 | 3300000955 | Soil | KLVTDPVTGWPALSAGPNAPTLSSREVEEILANFP* |
| JGI12659J15293_101072691 | 3300001546 | Forest Soil | EAGRIVLTPRKKRRHHVRIIADPVTGLPVLSAGSDAPLLRSKDVEEILANFP* |
| Ga0062389_1009902541 | 3300004092 | Bog Forest Soil | KKRTHRTKLVTDPITGLPAVSAGPNAPIMSSKEVEEMLANFP* |
| Ga0058882_15046991 | 3300004121 | Forest Soil | PRTKRPHRVKLVTDPITGLPALSAGPNAPKLSSKEVEEILTNFP* |
| Ga0062388_1006960841 | 3300004635 | Bog Forest Soil | GRIVLTPGNKRRHRVKIVTDPATGLPAFSAGPDAPILTSKEVEEILANAP* |
| Ga0062388_1025362552 | 3300004635 | Bog Forest Soil | IVLTPRKKRPRRVKIIADPVTGLPVLSAGVDAPVFRSKEVEEILANFP* |
| Ga0070709_106741593 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDGGRIVLTPRKKRPYQVKIVTDRVTGMPVLTAGSDAPALSSKEVEEILTNFP* |
| Ga0070710_106322142 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLTPRRKRSRAGKIVTDPLTGLPVLSAGVDAPVLSSKEVEEILRTFP* |
| Ga0070761_100606311 | 3300005591 | Soil | RLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0068856_1003998991 | 3300005614 | Corn Rhizosphere | RIKLVTDPITGLPALTAGPTAPTLSSKEVEEILANFP* |
| Ga0068866_100528851 | 3300005718 | Miscanthus Rhizosphere | LTPRKKRPHRIKLVTDPITGLPALTAGPNAPTLSSKEVEEILANFP* |
| Ga0066903_1091597682 | 3300005764 | Tropical Forest Soil | IVTDPITGLPALSAGPDAPFLTSKEVREIVANFP* |
| Ga0068858_1023022192 | 3300005842 | Switchgrass Rhizosphere | TPRKKRPHRTKLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0073928_108249551 | 3300006893 | Iron-Sulfur Acid Spring | QTVKIVTDPVTKFPVLSAGSHAPVLSNAEIEEILANVP* |
| Ga0075436_1013372002 | 3300006914 | Populus Rhizosphere | RIVLTPRKKRAHRTKLVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP* |
| Ga0116105_10002804 | 3300009624 | Peatland | MPNIEDRQTILTPRQKAALVKFVTDPVTGLPALGAGPKAPALSSKKVKEILANFP* |
| Ga0116125_10130101 | 3300009628 | Peatland | RVKIVTDPATGLPAFSAGPDAPTLTSKEVEEILSNFP* |
| Ga0116224_100420494 | 3300009683 | Peatlands Soil | VKIVTDPVTRFPVLSAGSDAPVLTSAEVEEILTNFP* |
| Ga0116227_106212801 | 3300009709 | Host-Associated | SKKRARSIKIVSDPVTGFPVLSAGLKAPALSSKDVEEILASFP* |
| Ga0116101_10218453 | 3300009759 | Peatland | DPLDGNIEDGSIVLTPRKKRAHRARLVTDPVTGLAALSAGPKAPTLSSKEVEEISANFP* |
| Ga0116134_10580125 | 3300009764 | Peatland | NIEDGSIVLTPRKKRAHRARLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0099796_100999503 | 3300010159 | Vadose Zone Soil | RPHRIKMVTDPVTGLPALSAGPKAPTMSSREVEEILANFP* |
| Ga0074044_107130522 | 3300010343 | Bog Forest Soil | LTPRKKRPHRVKLVTDPVTGLPALSAGPDAPTLRSKEVEEILANFP* |
| Ga0074044_111323581 | 3300010343 | Bog Forest Soil | RTHRTKLVTDPITGLPALSAGPNAPTMSSKEVEEILANFP* |
| Ga0126378_130485812 | 3300010361 | Tropical Forest Soil | DPLDAKIENGRFVLTPQRRRAQRIKQVTDSITGLPALSAGQNAPTLSSKEVEEILANFP* |
| Ga0126381_1047781251 | 3300010376 | Tropical Forest Soil | AARSGPAKITADPLTGLPVLTAGPEAPVLTSQQVEEILAELS* |
| Ga0136449_1000845743 | 3300010379 | Peatlands Soil | MPISRLDEFVLTPGNKRRHRVKIETDPATGLPALSAGPDAPTLTSKEVEEILANFP* |
| Ga0137399_112629772 | 3300012203 | Vadose Zone Soil | EDGRIVLTPRKKRSHRVKFVTDPVTGLPALSAGPNAPMLSSKEVEEILTNFP* |
| Ga0137381_115088331 | 3300012207 | Vadose Zone Soil | IVLTPQKRRRHHAKIVTDRITGLPALSAGSDAPKLSSKEVGEILANFP* |
| Ga0137376_107387631 | 3300012208 | Vadose Zone Soil | IVLTPRKKRPHRVKFVTDAVTGLPALSAGPNAPTLTSKEVEESLANFP* |
| Ga0137379_115478801 | 3300012209 | Vadose Zone Soil | LTPRKKRAHRAKLVTDPVTGLPALSAGPNAPTLSSKE |
| Ga0137386_105457911 | 3300012351 | Vadose Zone Soil | KKRPHRVKFVTDAVTGLPALSAGPNAPTLTSKEVEESLANFP* |
| Ga0137369_101070061 | 3300012355 | Vadose Zone Soil | KRTHRTKLVIDPITGLPALSAGPNAPMMSSKEVEEILANFP* |
| Ga0137390_109079311 | 3300012363 | Vadose Zone Soil | TKLVTDPVTGLPALSAGPNAPTLTSKEVEEILANFP* |
| Ga0137373_104214093 | 3300012532 | Vadose Zone Soil | QMKIVTDPVTGLPALSAGPKAPALSSREVEEILTNFP* |
| Ga0137358_100177563 | 3300012582 | Vadose Zone Soil | VLTPHKKRPHRVKFVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0137395_104094303 | 3300012917 | Vadose Zone Soil | AKLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0164301_105229441 | 3300012960 | Soil | TKLVTDPVTGLPALSAGPNAPTLSSREVEEILANFP* |
| Ga0181530_104483621 | 3300014159 | Bog | RPHRVKLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0182018_100031716 | 3300014489 | Palsa | VLTPRRKRPHRIKMVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP* |
| Ga0182016_102489521 | 3300014493 | Bog | KRQHRVKFVTDPVTGLAALSAGPKAPPLTSKEVEEILENFPD* |
| Ga0182015_108798692 | 3300014495 | Palsa | EAGSVILTPLKKRPHKGRIIADPVTGLPVLSAGADAPALSSKEVEEIVANFP* |
| Ga0181516_102458593 | 3300014655 | Bog | SIVLTPRKKRAHRVRLVTDPVTGLPALSAGPKAPTLSSKEVEEILANFP* |
| Ga0137405_10009451 | 3300015053 | Vadose Zone Soil | KRSHRAKIVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP* |
| Ga0182034_112779042 | 3300016371 | Soil | KKRPPRTKLVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP |
| Ga0182040_100314608 | 3300016387 | Soil | PRKKRPPRTKLVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP |
| Ga0187818_101761933 | 3300017823 | Freshwater Sediment | VLTPRKKRRQPVKIVTDPVTRFPVLSAGSDAPVLTSAEVEEILTNFP |
| Ga0187801_100742505 | 3300017933 | Freshwater Sediment | LTPPKKRPRQVKIVTDPITGFRVLSAGPEAPALSSKEVEEILTNFP |
| Ga0187850_101882141 | 3300017941 | Peatland | DGSIVLTPRKKRTYRARLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP |
| Ga0187879_106416152 | 3300017946 | Peatland | VEAGSIVLTPRRKRLRTARIVADPVTALPVLSAGVDAPVMMSKDVEEILANFP |
| Ga0187847_100204803 | 3300017948 | Peatland | MPNIEDRQTILTPRQKAALVKFVTDPVTGLPALGAGPKAPALSSKKVKEILANFP |
| Ga0187816_100295734 | 3300017995 | Freshwater Sediment | PVKIVTDPVTRFPVLSAGSDAPVLTSAEVEEILTNFP |
| Ga0187876_11640853 | 3300018003 | Peatland | RPHRVKLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP |
| Ga0187804_103106432 | 3300018006 | Freshwater Sediment | IVLTPHKKRPRQARIVNDTLTGLPVLTVGSDAPPLTGKEVSEILTNFP |
| Ga0187810_103197872 | 3300018012 | Freshwater Sediment | VLTPRRKRARHVKITTGPVTGLPVLSAGPDAPTLSSKEVEEILANLP |
| Ga0187875_103743953 | 3300018035 | Peatland | LTARIVRDPLTRLPVLSAGRGAPTLSSKEVAEILAEFP |
| Ga0187883_106754851 | 3300018037 | Peatland | LDANIEDGSIVLTPRKKRAHRAKLVTNPVTGLPALSAGPHAPTLSSKEVEEIL |
| Ga0187855_104680992 | 3300018038 | Peatland | MRNKVFTKRMPNIEDRQTILTPRQKAALVKFVTDPVTGLPALGAGPKAPALSSKKVKEILANFP |
| Ga0187855_108806821 | 3300018038 | Peatland | NIEAGRIVLTPGNKRRHRVKIVTDPATGLPAFSAGPDAPTLTSKEVEEILSNFP |
| Ga0187859_101200084 | 3300018047 | Peatland | NIEDGSIVLTPRKKRAHRARLVTDPVTGLPALSAGPNAPTLSSKEVEELLATFP |
| Ga0187858_102160811 | 3300018057 | Peatland | NIEDGSIVLTPRKKRAHRAKLVTDPVTGLPALSAGPNAPTLSSKEVEETLANFP |
| Ga0210399_100435611 | 3300020581 | Soil | MAHIKDRRIVLTPRTKRPFPAKLVTDLATGLPALSAGPDAPVLTSEEIEQLLADFP |
| Ga0210399_104164271 | 3300020581 | Soil | IEAGRIVLTPRKKRQQPVKIVTDPITRFPVLSAGLDAPVLTSAEVEEILANFP |
| Ga0210399_105210301 | 3300020581 | Soil | MQTRPHRVKFVTDPVTGLPALSAGPNAPVLTSKEVEE |
| Ga0210388_101256623 | 3300021181 | Soil | LTPRRKRPYRIKLVTDPVTGLPALSAGPKAPPLSSKEVEEILANFP |
| Ga0210387_102420431 | 3300021405 | Soil | VLTPRRKRPYRIKLVTDPVTGLPALSAGPKAPPLSSKEVEEILANFP |
| Ga0182009_100609484 | 3300021445 | Soil | VNVESGRIVLTPQKSRRLRVKIATDSVTGLPVFSAGPDARVLSSKEVEEILASFP |
| Ga0210402_116619891 | 3300021478 | Soil | AHRAKLVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP |
| Ga0242660_12317922 | 3300022531 | Soil | LDANIEDGSIVLTPRKKRAHRAKLVTDPVTGLPALSPGPNAPTLSSKEVEEILSNFP |
| Ga0242655_102547821 | 3300022532 | Soil | KKRSQPAKITTDPMTGLPVLSVGPDVPELSSKEVEEILANFP |
| Ga0208191_1000020114 | 3300025496 | Peatland | VLTPGKKRPHRVKLVTDPITGLPALSAGPNAPTLSSKEVEEILANFP |
| Ga0208586_11374551 | 3300025588 | Arctic Peat Soil | RKVRIMVDPVTGLPVLHAGVDAPLLRSKEVEEILANFP |
| Ga0207692_108730212 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLTPRRKRSRAGKIVTDPLTGLPVLSAGVDAPVLSSKEVEEILRTFP |
| Ga0207699_109803932 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDGGRIVLTPRKKRPYQVKIVTDRVTGMPVLTAGSDAPALSSKEVEEILTNFP |
| Ga0209159_12020991 | 3300026343 | Soil | YQIKLLTDPATGLPALSAGPDAPTLSSKEVEEILANFP |
| Ga0209577_108411682 | 3300026552 | Soil | KTGIVTDPVTGLPSLSAGPDAPVMSSNEVREILANFP |
| Ga0209421_11288941 | 3300027432 | Forest Soil | NVEAGSIVLTPRNKRTLRAKIVTDPLTGLPVLSVGTDSPELSSKEVEEILTNFP |
| Ga0209117_10015291 | 3300027645 | Forest Soil | KRPHRIKMVTDPVTGLPTLSAGPKAPTMSSKKVEEILANFP |
| Ga0208696_11432111 | 3300027696 | Peatlands Soil | VKIVTDPVTRFPVLSAGSDAPVLTSAEVEEILTNFP |
| Ga0209040_100877001 | 3300027824 | Bog Forest Soil | RQRSRAAKIVTDAVTGLPVLTAGPEAPTLSSKEVEEILANFP |
| Ga0209624_105113701 | 3300027895 | Forest Soil | AGRIVLTPRKKRRHHVRIIADPVTGLPVLSAGSDAPLLRSKDVEEILANFP |
| Ga0209624_107901451 | 3300027895 | Forest Soil | RPHRIKMVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP |
| Ga0209415_101771091 | 3300027905 | Peatlands Soil | MPISRLDEFVLTPGNKRRHRVKIETDPATGLPALSAGPDAPTLTSKEVEEILANFP |
| Ga0209698_100481945 | 3300027911 | Watersheds | VLTPRKKRPHRVKLVTDPVTGLPALSAGPSAPTLSSKEVEEILANFP |
| Ga0265353_10069313 | 3300028015 | Soil | RKRPHRIKMVTDPVTGLPAFSAGPKAPTMSSKEVEEILANFP |
| Ga0302224_101629673 | 3300028759 | Palsa | GSIILTPVKRRPHKVRIIADPVTGLPVLSAGADAPVLSSKEVEEILANFP |
| Ga0307504_103065442 | 3300028792 | Soil | RKKRSHRAKIVTDPVTGLPALSAGPNAPTLSSKEVEEILANFP |
| Ga0302278_102269603 | 3300028866 | Bog | QHRVKFVTDPVTGLPALSAGPAAPPLTSREVEEILESFPE |
| Ga0311329_109135661 | 3300029907 | Bog | NVENGRIILTPRSKRQHRVKFVTDPVTGLAALSAGPKAPPLTSKEVEEILENFPD |
| Ga0311340_102255421 | 3300029943 | Palsa | TPLKKRHLKTGIVADPVTGLPVLSAGSGAPILNSKDVEEILANFS |
| Ga0311342_102239111 | 3300029955 | Bog | NGRIILTPRSKRQHRVKFVTDPVTGLAALSAGPKAPPLTSKEVEEILENFPD |
| Ga0311338_112197951 | 3300030007 | Palsa | RIVLTPRKKRPHRAKIIADPVTGLPVLSAGVDAPVFRSKEVEEILANFP |
| Ga0302177_104035311 | 3300030053 | Palsa | GRIVLTPRKKRPHRAKIIADPVTGLPVLSAGVDAPVFRSKEVEEILANFP |
| Ga0302179_1000059522 | 3300030058 | Palsa | VLTPRKKRAHRAKLVTDPVTGLPALSAGPNAPTLSSKEVEEILASFP |
| Ga0311355_108528161 | 3300030580 | Palsa | PLDAEVEAGCIILTPLKKRPHKGRIIADPVTGLPVLSAGADAPVLSSKEVEEILANFP |
| Ga0310038_103988802 | 3300030707 | Peatlands Soil | KKRRQPVKIVTDPVTRFPVLSAGSDAPVLTSAEVEEILTNFP |
| Ga0170820_148783542 | 3300031446 | Forest Soil | ATKGPIIRTPLKKRPHKGRIIADPVTGLPVLSAGADAPALTSKEVEEIVANFP |
| Ga0318534_105699941 | 3300031544 | Soil | EDGRIVLTPRKKRPHRTKLVTDPVTGLPALSAGPNAPTMSSKEVEEILANFP |
| Ga0310686_1118723493 | 3300031708 | Soil | AGSIILTPLKKRLHKGKILADPVTGLPVLSAGADAPVLSSKEVEEIIANFP |
| Ga0306923_102824104 | 3300031910 | Soil | VLTPLRKRLHRVSIIADPITGLPVLSAGLDAPVLSSKEVEDILVNFP |
| Ga0307479_116030792 | 3300031962 | Hardwood Forest Soil | VRFVTDAVTGLPALSAGPNAPTLSSREVEEILANFP |
| Ga0335079_117550141 | 3300032783 | Soil | LTPHQKRTRQAKIVTDPVTGLPMLSAGPEAPALSSKEVAEVLANFP |
| Ga0335078_112751181 | 3300032805 | Soil | GKIVTDPVTRLPVLSAGADAPTLSSKEVEEILTNFP |
| Ga0326728_100162606 | 3300033402 | Peat Soil | VLTPRKKRPHQGKIVKDPITGLPAFSAGADAPPLTSKEVAEILASFP |
| Ga0370515_0124944_77_220 | 3300034163 | Untreated Peat Soil | VLTPRRQRRRPAKIVTDAVTGLPVLTVGPEAPALTSREVEEILASFP |
| ⦗Top⦘ |