


| Basic Information | |
|---|---|
| Family ID | F094437 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 23.58 % |
| % of genes near scaffold ends (potentially truncated) | 35.85 % |
| % of genes from short scaffolds (< 2000 bps) | 83.96 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.660 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.698 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.264 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 12.26 |
| PF03466 | LysR_substrate | 10.38 |
| PF00126 | HTH_1 | 8.49 |
| PF01526 | DDE_Tnp_Tn3 | 5.66 |
| PF07694 | 5TM-5TMR_LYT | 4.72 |
| PF00216 | Bac_DNA_binding | 3.77 |
| PF00106 | adh_short | 2.83 |
| PF04199 | Cyclase | 1.89 |
| PF13564 | DoxX_2 | 0.94 |
| PF01145 | Band_7 | 0.94 |
| PF08281 | Sigma70_r4_2 | 0.94 |
| PF10129 | OpgC_C | 0.94 |
| PF00356 | LacI | 0.94 |
| PF01471 | PG_binding_1 | 0.94 |
| PF07929 | PRiA4_ORF3 | 0.94 |
| PF13460 | NAD_binding_10 | 0.94 |
| PF13593 | SBF_like | 0.94 |
| PF07883 | Cupin_2 | 0.94 |
| PF12697 | Abhydrolase_6 | 0.94 |
| PF01488 | Shikimate_DH | 0.94 |
| PF04397 | LytTR | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 5.66 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 4.72 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 3.77 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.66 % |
| All Organisms | root | All Organisms | 44.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_101695095 | Not Available | 655 | Open in IMG/M |
| 3300001545|JGI12630J15595_10001951 | All Organisms → cellular organisms → Bacteria | 4499 | Open in IMG/M |
| 3300001593|JGI12635J15846_10145188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 1635 | Open in IMG/M |
| 3300001661|JGI12053J15887_10174406 | Not Available | 1111 | Open in IMG/M |
| 3300001661|JGI12053J15887_10336957 | Not Available | 732 | Open in IMG/M |
| 3300001867|JGI12627J18819_10062443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1551 | Open in IMG/M |
| 3300001867|JGI12627J18819_10070518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → unclassified Bdellovibrio → Bdellovibrio sp. NC01 | 1453 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100000102 | All Organisms → cellular organisms → Bacteria | 34605 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100451842 | Not Available | 1162 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100547492 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101007369 | Not Available | 718 | Open in IMG/M |
| 3300002906|JGI25614J43888_10004614 | All Organisms → cellular organisms → Bacteria | 4379 | Open in IMG/M |
| 3300002914|JGI25617J43924_10121767 | Not Available | 918 | Open in IMG/M |
| 3300002917|JGI25616J43925_10027612 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300003219|JGI26341J46601_10107956 | Not Available | 806 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10088474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium SDU3-3 | 1223 | Open in IMG/M |
| 3300004092|Ga0062389_102360068 | Not Available | 703 | Open in IMG/M |
| 3300005332|Ga0066388_108573713 | Not Available | 509 | Open in IMG/M |
| 3300005434|Ga0070709_11332718 | Not Available | 580 | Open in IMG/M |
| 3300005436|Ga0070713_102035334 | Not Available | 557 | Open in IMG/M |
| 3300005445|Ga0070708_100010431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 7532 | Open in IMG/M |
| 3300005445|Ga0070708_100241140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1697 | Open in IMG/M |
| 3300005467|Ga0070706_100698870 | Not Available | 940 | Open in IMG/M |
| 3300005467|Ga0070706_100944660 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005467|Ga0070706_101657567 | Not Available | 583 | Open in IMG/M |
| 3300005471|Ga0070698_101517466 | Not Available | 621 | Open in IMG/M |
| 3300005559|Ga0066700_10158495 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300005559|Ga0066700_10642289 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005712|Ga0070764_10388928 | Not Available | 822 | Open in IMG/M |
| 3300005921|Ga0070766_10265642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium SDU3-3 | 1093 | Open in IMG/M |
| 3300006028|Ga0070717_10014002 | All Organisms → cellular organisms → Bacteria | 6161 | Open in IMG/M |
| 3300006059|Ga0075017_100305114 | Not Available | 1177 | Open in IMG/M |
| 3300006163|Ga0070715_10808715 | Not Available | 569 | Open in IMG/M |
| 3300006354|Ga0075021_10219515 | Not Available | 1164 | Open in IMG/M |
| 3300006797|Ga0066659_11526624 | Not Available | 560 | Open in IMG/M |
| 3300007258|Ga0099793_10346855 | Not Available | 725 | Open in IMG/M |
| 3300007788|Ga0099795_10596036 | Not Available | 525 | Open in IMG/M |
| 3300009038|Ga0099829_10673142 | Not Available | 860 | Open in IMG/M |
| 3300010154|Ga0127503_10077776 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300012189|Ga0137388_10347167 | Not Available | 1368 | Open in IMG/M |
| 3300012200|Ga0137382_11208968 | Not Available | 537 | Open in IMG/M |
| 3300012202|Ga0137363_10722214 | Not Available | 844 | Open in IMG/M |
| 3300012202|Ga0137363_11107009 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012202|Ga0137363_11561686 | Not Available | 552 | Open in IMG/M |
| 3300012205|Ga0137362_10754601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300012205|Ga0137362_10761764 | Not Available | 830 | Open in IMG/M |
| 3300012205|Ga0137362_11172471 | Not Available | 652 | Open in IMG/M |
| 3300012210|Ga0137378_11631990 | Not Available | 553 | Open in IMG/M |
| 3300012362|Ga0137361_10576637 | Not Available | 1031 | Open in IMG/M |
| 3300012685|Ga0137397_11044516 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012924|Ga0137413_10934166 | Not Available | 676 | Open in IMG/M |
| 3300012927|Ga0137416_12123304 | Not Available | 516 | Open in IMG/M |
| 3300012930|Ga0137407_11387498 | Not Available | 668 | Open in IMG/M |
| 3300012957|Ga0164303_10641449 | Not Available | 706 | Open in IMG/M |
| 3300012960|Ga0164301_10998744 | Not Available | 657 | Open in IMG/M |
| 3300012989|Ga0164305_10384817 | Not Available | 1069 | Open in IMG/M |
| 3300020581|Ga0210399_10188109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 1715 | Open in IMG/M |
| 3300020583|Ga0210401_10811044 | Not Available | 796 | Open in IMG/M |
| 3300020583|Ga0210401_10940559 | Not Available | 723 | Open in IMG/M |
| 3300020583|Ga0210401_11461809 | Not Available | 541 | Open in IMG/M |
| 3300021046|Ga0215015_11044131 | All Organisms → cellular organisms → Bacteria | 2969 | Open in IMG/M |
| 3300021171|Ga0210405_10036748 | All Organisms → cellular organisms → Bacteria | 3907 | Open in IMG/M |
| 3300021171|Ga0210405_10554174 | Not Available | 898 | Open in IMG/M |
| 3300021171|Ga0210405_10656365 | Not Available | 813 | Open in IMG/M |
| 3300021178|Ga0210408_10085638 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300021178|Ga0210408_11521919 | Not Available | 500 | Open in IMG/M |
| 3300021180|Ga0210396_11234402 | Not Available | 624 | Open in IMG/M |
| 3300021403|Ga0210397_10457465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 961 | Open in IMG/M |
| 3300021403|Ga0210397_11333635 | Not Available | 557 | Open in IMG/M |
| 3300021406|Ga0210386_11278403 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300021420|Ga0210394_10579492 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300021479|Ga0210410_10881084 | Not Available | 782 | Open in IMG/M |
| 3300021559|Ga0210409_10124449 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
| 3300021559|Ga0210409_10671502 | Not Available | 906 | Open in IMG/M |
| 3300022724|Ga0242665_10262670 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300023056|Ga0233357_1001226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1884 | Open in IMG/M |
| 3300024271|Ga0224564_1087556 | Not Available | 628 | Open in IMG/M |
| 3300025320|Ga0209171_10013017 | All Organisms → cellular organisms → Bacteria | 7363 | Open in IMG/M |
| 3300025898|Ga0207692_10411453 | Not Available | 845 | Open in IMG/M |
| 3300025915|Ga0207693_10232225 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300025922|Ga0207646_10838197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 818 | Open in IMG/M |
| 3300026446|Ga0257178_1005549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1283 | Open in IMG/M |
| 3300026508|Ga0257161_1079213 | Not Available | 677 | Open in IMG/M |
| 3300026514|Ga0257168_1118396 | Not Available | 590 | Open in IMG/M |
| 3300026551|Ga0209648_10198710 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300027326|Ga0209731_1005906 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300027521|Ga0209524_1001748 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300027521|Ga0209524_1005912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2347 | Open in IMG/M |
| 3300027521|Ga0209524_1016260 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1523 | Open in IMG/M |
| 3300027537|Ga0209419_1019203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1237 | Open in IMG/M |
| 3300027546|Ga0208984_1099311 | Not Available | 629 | Open in IMG/M |
| 3300027610|Ga0209528_1000092 | All Organisms → cellular organisms → Bacteria | 11056 | Open in IMG/M |
| 3300027629|Ga0209422_1011609 | Not Available | 2172 | Open in IMG/M |
| 3300027738|Ga0208989_10008952 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300027812|Ga0209656_10003137 | All Organisms → cellular organisms → Bacteria | 10728 | Open in IMG/M |
| 3300027846|Ga0209180_10509282 | Not Available | 673 | Open in IMG/M |
| 3300027855|Ga0209693_10119374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1306 | Open in IMG/M |
| 3300027895|Ga0209624_10884409 | Not Available | 583 | Open in IMG/M |
| 3300027915|Ga0209069_10765660 | Not Available | 573 | Open in IMG/M |
| 3300030991|Ga0073994_12346824 | Not Available | 592 | Open in IMG/M |
| 3300031708|Ga0310686_107697456 | Not Available | 1060 | Open in IMG/M |
| 3300031718|Ga0307474_10214944 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300031753|Ga0307477_10573053 | Not Available | 763 | Open in IMG/M |
| 3300031954|Ga0306926_10857888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300031962|Ga0307479_10642499 | Not Available | 1042 | Open in IMG/M |
| 3300031962|Ga0307479_11057187 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 19.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.83% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1016950952 | 3300000955 | Soil | MKMTTDIDQFSHVEKIATLTQLYLELMLPLQDALRAAEADL* |
| JGI12630J15595_100019513 | 3300001545 | Forest Soil | MSPDIDQSSYAKKLATLTQLYLELNLPLMDALRAAEADL* |
| JGI12635J15846_101451883 | 3300001593 | Forest Soil | PLLTNYDSMKMSINIDQFLYVEKLATLTQLYLELKLPLHDALRAAEADL* |
| JGI12053J15887_101744062 | 3300001661 | Forest Soil | MSSDIDPFLYVENLAMLTQLYLELRLPLKEALRAAEADL* |
| JGI12053J15887_103369572 | 3300001661 | Forest Soil | MSPDIEQFSHVKKLATLTQLYLELNMPLRDALRAAEADL* |
| JGI12627J18819_100624433 | 3300001867 | Forest Soil | MSADIDRFPSDKKLLMLTQLYLELRLSLGDALRAAKADLSAPE* |
| JGI12627J18819_100705182 | 3300001867 | Forest Soil | MKMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL* |
| JGIcombinedJ26739_1000001029 | 3300002245 | Forest Soil | MKMSPDIDQSSYAKKLATLTQLYLELNLPLMDALRAAEADL* |
| JGIcombinedJ26739_1004518423 | 3300002245 | Forest Soil | MPLLTNYHSMKMSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL* |
| JGIcombinedJ26739_1005474921 | 3300002245 | Forest Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATXTQLYLELRLPXQDALRAAEADL* |
| JGIcombinedJ26739_1010073691 | 3300002245 | Forest Soil | SNNIDQFWFVEKLTTLTQLYLELRLPVHDALRAAEADL* |
| JGI25614J43888_100046141 | 3300002906 | Grasslands Soil | MSINIDQFSYFEKLAVLTRLYLELSLPVPEALRAAKADL* |
| JGI25617J43924_101217671 | 3300002914 | Grasslands Soil | KMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL* |
| JGI25616J43925_100276124 | 3300002917 | Grasslands Soil | MKMSTNIDQFSYFEKLATLTRLYLELSLPVPEALRAAKADL* |
| JGI26341J46601_101079562 | 3300003219 | Bog Forest Soil | MKMSTDISQFSYLDKLATLTRLYFELGLPSPDALRAAEADL* |
| JGIcombinedJ51221_100884743 | 3300003505 | Forest Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0062389_1023600682 | 3300004092 | Bog Forest Soil | MKMIDIRQFSHLEKLVALTRLYLELRLPLAGALRAATADLQMES |
| Ga0066388_1085737131 | 3300005332 | Tropical Forest Soil | MKMSAYIDQLPYAEKLATLTQLYLELSLPLENALRAAEADLCH |
| Ga0070709_113327182 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLPTNYHFMKMTTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0070713_1020353341 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMSANIDQFSYFEKLATLTRLYLELSLPVPEALRAAKADL* |
| Ga0070708_1000104315 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLANYHCMKMSTDIDQFSHVEKLATLTQLYLELRLSLQEALRAAEADL* |
| Ga0070708_1002411403 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKISTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0070706_1006988702 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLTNYDSMKMSNNIDQFSLVEKLTTLTQLYLELRLPLHDALRAAEADL* |
| Ga0070706_1009446602 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMITDIDQFSHVEKLSMLTQLYLQLRLPLQDALRAAEADL* |
| Ga0070706_1016575671 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMTTDIDQFSHVEKLATLTQLYLELRLPLHDALRAAEADL* |
| Ga0070698_1015174662 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLTNYHFMKISTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0066700_101584952 | 3300005559 | Soil | MPLLTNYDSMKMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL* |
| Ga0066700_106422892 | 3300005559 | Soil | MSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0070764_103889282 | 3300005712 | Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAAEADL* |
| Ga0070766_102656422 | 3300005921 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0070717_100140023 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPILTNYHFMKISTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0075017_1003051142 | 3300006059 | Watersheds | NYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAAEADL* |
| Ga0070715_108087151 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDIDQFSHVEKLATLTQLYLELRLPLHDALRAAEADL* |
| Ga0075021_102195152 | 3300006354 | Watersheds | MKMTTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0066659_115266242 | 3300006797 | Soil | MKMSTDIDQFSPVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0099793_103468551 | 3300007258 | Vadose Zone Soil | MPLFTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLHDALRAAEADL* |
| Ga0099795_105960361 | 3300007788 | Vadose Zone Soil | MKMTTDIDQFSDVEQLAALTQLYLELRLPLQDALRAAEADLWDP* |
| Ga0099829_106731421 | 3300009038 | Vadose Zone Soil | HSLPTTILMKMSINIDQFSYVEKLATLTQLYLELRLPLHDALRAAEADL* |
| Ga0127503_100777764 | 3300010154 | Soil | MKMSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0137388_103471672 | 3300012189 | Vadose Zone Soil | MKMSINIDQFSYVEKLATLTQLYLELRLPLHDALRAAEADL* |
| Ga0137382_112089681 | 3300012200 | Vadose Zone Soil | HSMKMSPDIDQSSYVKKLVTLTQLYLELNLPSMDALRAAEADL* |
| Ga0137363_107222142 | 3300012202 | Vadose Zone Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEA |
| Ga0137363_111070091 | 3300012202 | Vadose Zone Soil | MPLFTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0137363_115616862 | 3300012202 | Vadose Zone Soil | LTNYDSMKMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL* |
| Ga0137362_107546013 | 3300012205 | Vadose Zone Soil | MKMGPDIDQSLYVKKLATLTQLYLGLNLLLMDGLRAAEADL |
| Ga0137362_107617642 | 3300012205 | Vadose Zone Soil | MKMTIDIDQFSHVEKIATLTQLYLELMLPLQDALRAAEADL* |
| Ga0137362_111724711 | 3300012205 | Vadose Zone Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAKADL* |
| Ga0137378_116319901 | 3300012210 | Vadose Zone Soil | MKMSTDIDQFSLVEKLATLTQLYLALRLPLQDALRAAEADL* |
| Ga0137361_105766371 | 3300012362 | Vadose Zone Soil | MKVTIDIDQFSDVEQLAALTQLYLELRLPLQDALRAAEADLWDP* |
| Ga0137397_110445162 | 3300012685 | Vadose Zone Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLRDALRAAEADL* |
| Ga0137413_109341662 | 3300012924 | Vadose Zone Soil | FSDVEQLAALTQLYLELRLPLQDALRAAEADLWDP* |
| Ga0137416_121233042 | 3300012927 | Vadose Zone Soil | FMKMSTVIDQFSHVEKLATLTPLYLELRLPLQDALRAAEADL* |
| Ga0137407_113874981 | 3300012930 | Vadose Zone Soil | MKMSIDIDQFSYAEKLATLTQRYLELRLSLQDALRAAEADP* |
| Ga0164303_106414492 | 3300012957 | Soil | MKMSTDIDQFSHVEKLATLTQLYLKLRLPLRDALRAAEADL* |
| Ga0164301_109987442 | 3300012960 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLRDALRAAEA |
| Ga0164305_103848171 | 3300012989 | Soil | STDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL* |
| Ga0210399_101881094 | 3300020581 | Soil | CASDLEALMPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210401_108110442 | 3300020583 | Soil | MKLSINIDQFSYVEKLATLTQLYLELRLPLHDALQAVE |
| Ga0210401_109405592 | 3300020583 | Soil | DIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210401_114618092 | 3300020583 | Soil | MIDIPQISHLEKLVALTRLYLELRLPLAGALRAATADLQMESLP |
| Ga0215015_110441312 | 3300021046 | Soil | MRPDIDQSSHVKKLATLTQLYLELNLSLMDALRAAQADL |
| Ga0210405_100367484 | 3300021171 | Soil | MPLLTNYHFMKISTDIDQFSHVEKLATLTQLYLELSLPLQDALRAAEADL |
| Ga0210405_105541741 | 3300021171 | Soil | MPLLANYHSMKMRTNIDQFSLVEKLATLTQLYLALRLPLQDALRAAEADL |
| Ga0210405_106563652 | 3300021171 | Soil | MPLLTNYHFMKMSTDIDQLSGVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210408_100856381 | 3300021178 | Soil | GPSVNNIDQFWYVEKLTTLTHLYLELRLPLHDALRAAEADL |
| Ga0210408_115219191 | 3300021178 | Soil | MSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210396_112344022 | 3300021180 | Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATLTHLYLELRLPLQDALRAAEADL |
| Ga0210397_104574652 | 3300021403 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210397_113336351 | 3300021403 | Soil | LTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210386_112784031 | 3300021406 | Soil | HFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210394_105794922 | 3300021420 | Soil | IDQFVYVEKIATLTQLYLELKLPLHDALRAAEADL |
| Ga0210410_108810842 | 3300021479 | Soil | SELETLMPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0210409_101244492 | 3300021559 | Soil | MKMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL |
| Ga0210409_106715022 | 3300021559 | Soil | MKMSTDIDQFSLVEKLVTLTQLYLELRLPLQDALRAAEADL |
| Ga0242665_102626701 | 3300022724 | Soil | LTNYHSMKMSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0233357_10012262 | 3300023056 | Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAAEADL |
| Ga0224564_10875562 | 3300024271 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPLHDALRAAEADL |
| Ga0209171_100130179 | 3300025320 | Iron-Sulfur Acid Spring | MPLLTNYDSMKISINIDQFLYVEKLATLTQLYLELKLPLHDALRAAEADL |
| Ga0207692_104114531 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | HFMKMTTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0207693_102322253 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPLRDALRAAEADL |
| Ga0207646_108381972 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKISTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0257178_10055492 | 3300026446 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAAEADL |
| Ga0257161_10792132 | 3300026508 | Soil | MSADIDQFSQVKKLATLTRLYLELNMPLMDALRAAEADL |
| Ga0257168_11183961 | 3300026514 | Soil | MKMSTDIDQFSHVEKLATLTQLYLELRLPIQDALRAAEADL |
| Ga0209648_101987101 | 3300026551 | Grasslands Soil | KMSNNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL |
| Ga0209731_10059061 | 3300027326 | Forest Soil | NNIDQFWYVEKLTTLTQLYLELRLPLHDALRAAEADL |
| Ga0209524_10017484 | 3300027521 | Forest Soil | MKMSPDIDQSSYAKKLATLTQLYLELNLPLMDALRAAEADL |
| Ga0209524_10059125 | 3300027521 | Forest Soil | MPLLTNYHSMKMSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0209524_10162603 | 3300027521 | Forest Soil | MPLLTNYDSMKMSINIDQFSYVEKLATLTQLYLELRLPLHDALRAAEADL |
| Ga0209419_10192031 | 3300027537 | Forest Soil | SPDIDQSSYAKKLATLTQLYLELNLPLMDALRAAEADL |
| Ga0208984_10993111 | 3300027546 | Forest Soil | MPLLTNYHFMKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAADADL |
| Ga0209528_10000923 | 3300027610 | Forest Soil | MSPDIEQFSHVKKLATLTQLYLELNMPLRDALRAAEADL |
| Ga0209422_10116093 | 3300027629 | Forest Soil | MPLLTNYYFMKMSTDIDQFSHVEKLATLTQLYLELRLPVQDALRAAEADL |
| Ga0208989_100089522 | 3300027738 | Forest Soil | MKMSPNIDQFSYVKKLATLTQLYLELNLTLMDALRAADADL |
| Ga0209656_100031373 | 3300027812 | Bog Forest Soil | MKMSTDISQFSYLDKLATLTRLYFELGLPSPDALRAAEADL |
| Ga0209180_105092821 | 3300027846 | Vadose Zone Soil | NIDQFSYVEKLATLTQLYLELRLPLHDALRAAEADL |
| Ga0209693_101193741 | 3300027855 | Soil | MKMSIDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0209624_108844091 | 3300027895 | Forest Soil | MKMNTDIDQFSHVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0209069_107656601 | 3300027915 | Watersheds | MPLLTNYHFMKMSTDIDQFSLGEKLAALTQLYLELRLPLHDALRAAEA |
| Ga0073994_123468241 | 3300030991 | Soil | TNYHSMKMSTDIDQFTLVEKLATLTQLYLELRLPLQDALRAAEADL |
| Ga0310686_1076974562 | 3300031708 | Soil | MKMSMNIDQFLYVEKLATLTQLYLELRLPLHDALRAAEADL |
| Ga0307474_102149442 | 3300031718 | Hardwood Forest Soil | MKMRTNIDQFSLVEKLATLTQLYLALRLPLQDALRAAEADL |
| Ga0307477_105730532 | 3300031753 | Hardwood Forest Soil | MKMSTDIDQFSLVEKLATLTQLYLALRLPLQDALRAAEADL |
| Ga0306926_108578881 | 3300031954 | Soil | MKRSAYIDQLPYAEKLATLTQLYLELSLPLENALRAAKANL |
| Ga0307479_106424991 | 3300031962 | Hardwood Forest Soil | MKMSTDIDQFSLVEKLATLTQLYLALRLPLQDALRAAEADLC |
| Ga0307479_110571871 | 3300031962 | Hardwood Forest Soil | LETLMPLLTNYHSMKMSTDIDQFSLVEKLATLTQLYLELRLPLQDALRAAEADL |
| ⦗Top⦘ |