


| Basic Information | |
|---|---|
| Family ID | F094397 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKKKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.32 % |
| % of genes near scaffold ends (potentially truncated) | 19.81 % |
| % of genes from short scaffolds (< 2000 bps) | 59.43 % |
| Associated GOLD sequencing projects | 53 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.283 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (76.415 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.453 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.509 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.98% β-sheet: 0.00% Coil/Unstructured: 73.02% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 23.58 |
| PF03796 | DnaB_C | 6.60 |
| PF12705 | PDDEXK_1 | 6.60 |
| PF09588 | YqaJ | 5.66 |
| PF02086 | MethyltransfD12 | 3.77 |
| PF00589 | Phage_integrase | 2.83 |
| PF05866 | RusA | 1.89 |
| PF14090 | HTH_39 | 0.94 |
| PF00535 | Glycos_transf_2 | 0.94 |
| PF13539 | Peptidase_M15_4 | 0.94 |
| PF00772 | DnaB | 0.94 |
| PF12728 | HTH_17 | 0.94 |
| PF09374 | PG_binding_3 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 7.55 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.60 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 3.77 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 3.77 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.72 % |
| Unclassified | root | N/A | 45.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10000424 | Not Available | 26169 | Open in IMG/M |
| 3300001450|JGI24006J15134_10001662 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 12610 | Open in IMG/M |
| 3300001450|JGI24006J15134_10002600 | Not Available | 9864 | Open in IMG/M |
| 3300001450|JGI24006J15134_10104527 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1010 | Open in IMG/M |
| 3300001683|GBIDBA_10012017 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 5051 | Open in IMG/M |
| 3300002231|KVRMV2_100410368 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 763 | Open in IMG/M |
| 3300003690|PicViral_1000482 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 29855 | Open in IMG/M |
| 3300006164|Ga0075441_10160009 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 847 | Open in IMG/M |
| 3300006736|Ga0098033_1006010 | All Organisms → Viruses → Predicted Viral | 4120 | Open in IMG/M |
| 3300006736|Ga0098033_1174780 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 598 | Open in IMG/M |
| 3300006738|Ga0098035_1008349 | All Organisms → Viruses → Predicted Viral | 4332 | Open in IMG/M |
| 3300006738|Ga0098035_1011224 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 3660 | Open in IMG/M |
| 3300006738|Ga0098035_1076881 | Not Available | 1183 | Open in IMG/M |
| 3300006738|Ga0098035_1305137 | Not Available | 518 | Open in IMG/M |
| 3300006750|Ga0098058_1004720 | All Organisms → Viruses → Predicted Viral | 4185 | Open in IMG/M |
| 3300006751|Ga0098040_1002323 | Not Available | 7798 | Open in IMG/M |
| 3300006751|Ga0098040_1040285 | Not Available | 1472 | Open in IMG/M |
| 3300006751|Ga0098040_1057526 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1201 | Open in IMG/M |
| 3300006752|Ga0098048_1085621 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 961 | Open in IMG/M |
| 3300006752|Ga0098048_1126755 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 766 | Open in IMG/M |
| 3300006753|Ga0098039_1027980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 2009 | Open in IMG/M |
| 3300006753|Ga0098039_1231098 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 624 | Open in IMG/M |
| 3300006754|Ga0098044_1093989 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300006754|Ga0098044_1104083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium | 1161 | Open in IMG/M |
| 3300006754|Ga0098044_1326491 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 584 | Open in IMG/M |
| 3300006789|Ga0098054_1006129 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 5210 | Open in IMG/M |
| 3300006789|Ga0098054_1108644 | Not Available | 1036 | Open in IMG/M |
| 3300006789|Ga0098054_1200933 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 726 | Open in IMG/M |
| 3300006793|Ga0098055_1202265 | Not Available | 754 | Open in IMG/M |
| 3300006924|Ga0098051_1027784 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1612 | Open in IMG/M |
| 3300006925|Ga0098050_1097103 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 754 | Open in IMG/M |
| 3300006927|Ga0098034_1063032 | Not Available | 1082 | Open in IMG/M |
| 3300006928|Ga0098041_1179145 | Not Available | 679 | Open in IMG/M |
| 3300006928|Ga0098041_1264501 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 548 | Open in IMG/M |
| 3300006929|Ga0098036_1077237 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300008050|Ga0098052_1006626 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6350 | Open in IMG/M |
| 3300008050|Ga0098052_1009319 | Not Available | 5164 | Open in IMG/M |
| 3300008050|Ga0098052_1023284 | Not Available | 2911 | Open in IMG/M |
| 3300008050|Ga0098052_1147207 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 934 | Open in IMG/M |
| 3300008051|Ga0098062_1005475 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3110 | Open in IMG/M |
| 3300008220|Ga0114910_1005451 | All Organisms → cellular organisms → Bacteria | 5131 | Open in IMG/M |
| 3300009173|Ga0114996_10025300 | Not Available | 5816 | Open in IMG/M |
| 3300009173|Ga0114996_10125466 | Not Available | 2143 | Open in IMG/M |
| 3300009173|Ga0114996_10786282 | Not Available | 690 | Open in IMG/M |
| 3300009173|Ga0114996_10838409 | Not Available | 663 | Open in IMG/M |
| 3300009425|Ga0114997_10055509 | Not Available | 2529 | Open in IMG/M |
| 3300009425|Ga0114997_10521838 | Not Available | 631 | Open in IMG/M |
| 3300009441|Ga0115007_10614258 | Not Available | 724 | Open in IMG/M |
| 3300009595|Ga0105214_115535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 583 | Open in IMG/M |
| 3300009622|Ga0105173_1006693 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
| 3300009622|Ga0105173_1087871 | Not Available | 561 | Open in IMG/M |
| 3300010150|Ga0098056_1222402 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 628 | Open in IMG/M |
| 3300010150|Ga0098056_1259809 | Not Available | 575 | Open in IMG/M |
| 3300010151|Ga0098061_1005965 | Not Available | 5545 | Open in IMG/M |
| 3300010151|Ga0098061_1109609 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1023 | Open in IMG/M |
| 3300010153|Ga0098059_1006129 | Not Available | 5247 | Open in IMG/M |
| 3300010155|Ga0098047_10408064 | Not Available | 508 | Open in IMG/M |
| 3300010883|Ga0133547_10199091 | All Organisms → Viruses → Predicted Viral | 4270 | Open in IMG/M |
| 3300010883|Ga0133547_10562186 | Not Available | 2289 | Open in IMG/M |
| 3300020374|Ga0211477_10003524 | Not Available | 8750 | Open in IMG/M |
| 3300020395|Ga0211705_10109659 | Not Available | 1002 | Open in IMG/M |
| 3300020451|Ga0211473_10031171 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2640 | Open in IMG/M |
| 3300020470|Ga0211543_10508070 | Not Available | 572 | Open in IMG/M |
| 3300020472|Ga0211579_10008861 | All Organisms → cellular organisms → Bacteria | 6875 | Open in IMG/M |
| 3300020474|Ga0211547_10202538 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300020477|Ga0211585_10069741 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 2498 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10291638 | Not Available | 749 | Open in IMG/M |
| 3300025061|Ga0208300_102271 | All Organisms → cellular organisms → Bacteria | 5613 | Open in IMG/M |
| 3300025072|Ga0208920_1005386 | Not Available | 3001 | Open in IMG/M |
| 3300025084|Ga0208298_1067673 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 675 | Open in IMG/M |
| 3300025096|Ga0208011_1001216 | Not Available | 9224 | Open in IMG/M |
| 3300025096|Ga0208011_1016368 | Not Available | 1961 | Open in IMG/M |
| 3300025096|Ga0208011_1029565 | Not Available | 1351 | Open in IMG/M |
| 3300025096|Ga0208011_1045789 | Not Available | 1026 | Open in IMG/M |
| 3300025103|Ga0208013_1001311 | Not Available | 11761 | Open in IMG/M |
| 3300025103|Ga0208013_1007113 | All Organisms → Viruses → Predicted Viral | 3805 | Open in IMG/M |
| 3300025103|Ga0208013_1030941 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300025103|Ga0208013_1109909 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 688 | Open in IMG/M |
| 3300025109|Ga0208553_1006023 | All Organisms → Viruses → Predicted Viral | 3588 | Open in IMG/M |
| 3300025109|Ga0208553_1016823 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300025109|Ga0208553_1054901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 978 | Open in IMG/M |
| 3300025112|Ga0209349_1000599 | Not Available | 18137 | Open in IMG/M |
| 3300025112|Ga0209349_1023997 | Not Available | 2114 | Open in IMG/M |
| 3300025118|Ga0208790_1086006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium | 932 | Open in IMG/M |
| 3300025118|Ga0208790_1132374 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 702 | Open in IMG/M |
| 3300025125|Ga0209644_1098543 | Not Available | 691 | Open in IMG/M |
| 3300025132|Ga0209232_1220067 | Not Available | 567 | Open in IMG/M |
| 3300025133|Ga0208299_1007644 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 5770 | Open in IMG/M |
| 3300025141|Ga0209756_1323911 | Not Available | 534 | Open in IMG/M |
| 3300025151|Ga0209645_1045142 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1567 | Open in IMG/M |
| 3300025168|Ga0209337_1000577 | Not Available | 29530 | Open in IMG/M |
| 3300025168|Ga0209337_1005104 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 8990 | Open in IMG/M |
| 3300025168|Ga0209337_1040058 | Not Available | 2515 | Open in IMG/M |
| 3300025168|Ga0209337_1153634 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 993 | Open in IMG/M |
| 3300025218|Ga0207882_1028839 | Not Available | 801 | Open in IMG/M |
| 3300025251|Ga0208182_1007792 | All Organisms → Viruses → Predicted Viral | 3230 | Open in IMG/M |
| 3300025259|Ga0207876_1040252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 633 | Open in IMG/M |
| 3300026087|Ga0208113_1081584 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026117|Ga0208317_1009288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 583 | Open in IMG/M |
| 3300027779|Ga0209709_10184251 | Not Available | 987 | Open in IMG/M |
| 3300027844|Ga0209501_10021817 | Not Available | 5007 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10000191 | Not Available | 31054 | Open in IMG/M |
| 3300032048|Ga0315329_10569492 | Not Available | 602 | Open in IMG/M |
| 3300033742|Ga0314858_033809 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1192 | Open in IMG/M |
| 3300034654|Ga0326741_020149 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium TMED67 | 1188 | Open in IMG/M |
| 3300034654|Ga0326741_070169 | Not Available | 582 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 76.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.55% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.77% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 3.77% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.89% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.89% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.94% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume | 0.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300003690 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assembly | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008051 | Marine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300025061 | Marine viral communities from Cariaco Basin, Caribbean Sea - 23_WHOI_OMZ (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025218 | Marine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025259 | Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026117 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_1000042427 | 3300001450 | Marine | MTKRKKNINNNFRGAEDRFWKKVVNGLKKFLESPFK* |
| JGI24006J15134_1000166211 | 3300001450 | Marine | MAKRGRPRKNKPNNFRGSEDKFWSNVVKGLRKFLESPFK* |
| JGI24006J15134_1000260023 | 3300001450 | Marine | MPKRKNISNNFRGKEDIFWIKVKRGIKRFLEPAFKEK* |
| JGI24006J15134_101045275 | 3300001450 | Marine | MTKRKKNINNNFRGAEDKFWKKVVNGLKKFLESPFK* |
| GBIDBA_100120178 | 3300001683 | Hydrothermal Vent Plume | MKKSKKNIPNNFRGEEDIFWIKIKKGIKKFLEPAFKEK* |
| KVRMV2_1004103683 | 3300002231 | Marine Sediment | MPRKKRANKNIPNNFRGKEDRFWIKIVKGLKKFLESPFK* |
| PicViral_10004829 | 3300003690 | Marine, Hydrothermal Vent Plume | MKKRKNIDGNFRGWEDIFFIKIKKGLNKFFESPFKRGKK* |
| Ga0075441_101600092 | 3300006164 | Marine | MAKRGRPRKNKPNNFRGAEDKFWSNIVKGLKKFLESPFK* |
| Ga0098033_100601010 | 3300006736 | Marine | MKKKTKKNIPNNFRGKEDKFWSSIVKGLKNFLQSPFK* |
| Ga0098033_11747801 | 3300006736 | Marine | NKKKRNVPNNFRGVEDKFWTRIFKGIKNFLQSPFK* |
| Ga0098035_100834912 | 3300006738 | Marine | MKKKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK* |
| Ga0098035_101122412 | 3300006738 | Marine | MPRKKKNIPNNFRGEEDKFWSRIVKGLKKFLESPFK* |
| Ga0098035_10768813 | 3300006738 | Marine | MRRRKRKKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK* |
| Ga0098035_13051372 | 3300006738 | Marine | MPRKKNISNNFKGKEDIFWIKVKKGIKKFLEPAFKEK* |
| Ga0098058_10047204 | 3300006750 | Marine | MKKKTKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK* |
| Ga0098040_100232319 | 3300006751 | Marine | MKKLKKNIAGNFKGKEDIFWIKIKKGIKKFLEPAFKEK* |
| Ga0098040_10402853 | 3300006751 | Marine | MPRRKRKKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK* |
| Ga0098040_10575262 | 3300006751 | Marine | MPKKRKVRKNIPNNFRGKEDRFWTKVVKGLKSFLESPFK* |
| Ga0098048_10856215 | 3300006752 | Marine | MPKKKKNIPNNFRGKEDIFWIKVVKGFKKFLESPFK* |
| Ga0098048_11267551 | 3300006752 | Marine | KKRGRPRKNIPNNFRGTEDRFWSKIVKGLKKFLESPFK* |
| Ga0098039_10279802 | 3300006753 | Marine | MKKRKNIDGNFRGWEDIFFIKVKKGLKKFLESPFKGGKK* |
| Ga0098039_12310981 | 3300006753 | Marine | KRKGYTNIPNNFRGSEDIFWTKIVKGVRNFLQSPFK* |
| Ga0098044_10939891 | 3300006754 | Marine | MPKKRKTRKNIPNNFRGKEDRFWTKVVKGLKSFLESPFK* |
| Ga0098044_11040833 | 3300006754 | Marine | MKKKKKNIPNNFRGKEDLFWKKIADGLKVFLASPFKDNV* |
| Ga0098044_13264912 | 3300006754 | Marine | MKKKTKKNIPNNFRGKEDKFWSNIVKGLKNFLQSPFK* |
| Ga0098054_10061293 | 3300006789 | Marine | MPTKRKPRKKNIQGNFRGAEDKFWSNVIKGFKKFLKSPFK* |
| Ga0098054_11086445 | 3300006789 | Marine | ERLKMPRKKKNIPNNFRGEEDKFWSRIAKGLKKFLESPFK* |
| Ga0098054_12009332 | 3300006789 | Marine | MPKKKKNIDGNFRGKEDLFWKNVVKGFKKFLESPFKK* |
| Ga0098055_12022653 | 3300006793 | Marine | MPTKRKPKKKNIQGNFRGAEDKFWSNVIKGFKKFLES |
| Ga0098051_10277841 | 3300006924 | Marine | KKKTKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK* |
| Ga0098050_10971032 | 3300006925 | Marine | KKRKVRKNIPNNFRGKEDRFWTKVVKGLKSFLESPFK* |
| Ga0098034_10630323 | 3300006927 | Marine | MRRKKRKKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK* |
| Ga0098041_11791453 | 3300006928 | Marine | MPKKKKNTPNNFRGKEDIFWIKVVKGFKKFLESPFK* |
| Ga0098041_12645011 | 3300006928 | Marine | MPKKITKKKNIQGNFRGKEDLFFKKIRDVLKKFLESPFK |
| Ga0098036_10772371 | 3300006929 | Marine | KMPKKKKNTPNNFRGKEDIFWIKVVKGFKKFLESPFK* |
| Ga0098052_100662613 | 3300008050 | Marine | MPKKKNIPHNLRGSEDLFWSKVIKGFKKFLTPAFKRKRQDK* |
| Ga0098052_10093193 | 3300008050 | Marine | MKKLKKNIAGNFKGKEDIFWIKVKKGIKKFLEPAFKEK* |
| Ga0098052_10232841 | 3300008050 | Marine | RKNIPNNFRGKEDIFWIKIKKGIKKFLEPAFKEK* |
| Ga0098052_11472072 | 3300008050 | Marine | MPKKTTKKKNIPNNFRGKEDLFFKKVRDGLKKFLESPFK* |
| Ga0098062_10054753 | 3300008051 | Marine | MPKKRAYKRKNIPNNFRGKEDRFWTKIVKGLKKFLESPFK* |
| Ga0114910_100545110 | 3300008220 | Deep Ocean | MKKRKNINGNFRGWEDIFFIKIKKGLNKFFESPFKRGKK* |
| Ga0114996_1002530015 | 3300009173 | Marine | MKKSKKNIPNNFRGEEDIFWTKIKKGIKKFLKPAFN* |
| Ga0114996_101254664 | 3300009173 | Marine | MNPKPKAKSKKNIPNNFRGKEDVFWIKIKKGIKIFLEPAFKEK* |
| Ga0114996_107862823 | 3300009173 | Marine | MKRKKNIPNNFRGKEDKFWIKIKKGIKKFLEPAFKEK* |
| Ga0114996_108384092 | 3300009173 | Marine | MKKSKKNIPSNFRGEEDIFWIKIKKGIKKFLEPVFKEK* |
| Ga0114997_100555095 | 3300009425 | Marine | MPRKKNISNNFKGKEDIFWIKVKKGIKKFFEPAFKDK* |
| Ga0114997_105218383 | 3300009425 | Marine | MNPKPKTKSKKNIPNNFRGKEDIFWIKIKKGIKKFLEPAFREK* |
| Ga0115007_106142582 | 3300009441 | Marine | MNPKPKTKSKKNIPNNFRGKEDIFWIKIKKGIKTFL* |
| Ga0105214_1155351 | 3300009595 | Marine Oceanic | KKRKNIDGNFRGWEDIFFIKIKKGLNKFFESPFKRGKK* |
| Ga0105173_10066932 | 3300009622 | Marine Oceanic | MKKRKNIDGNFRGWEDIFFISIKKGLKKFLESPFKRTKK* |
| Ga0105173_10878711 | 3300009622 | Marine Oceanic | MPRKKNKPGNFRGKEDLFWKKVRDGLKKFLQSPFK* |
| Ga0098056_12224021 | 3300010150 | Marine | MEMPTKRKPRKKNIQGNFRGAEDKFWSNVIKGFKKFLKSPFK* |
| Ga0098056_12598091 | 3300010150 | Marine | MPKQKRKKNIPNNFRGKEDKFWSNVIKGLKKFLESPFK* |
| Ga0098061_100596513 | 3300010151 | Marine | MKKKTKSKKNIPNNLRGAEDKFWSNIVKGLKKFLESPFK* |
| Ga0098061_11096093 | 3300010151 | Marine | MPTKRKTKKKNIQGNFRGAEDKFWSNVIKGFKKFLESPFK* |
| Ga0098059_100612910 | 3300010153 | Marine | MKKRKNIPNNFRGKEDIFWIKIKKGIKKFLEPAFKEK* |
| Ga0098047_104080641 | 3300010155 | Marine | RLKMPRKKKNIPNNFRGEEDKFWSRIVKGLKKFLESPFK* |
| Ga0133547_101990914 | 3300010883 | Marine | MKKTKKNIPNNFRGSEDVFWIKIKRGMRKFLKPAFKKEK* |
| Ga0133547_105621861 | 3300010883 | Marine | MPKTKKIAGNFRGSEDIFWTKVVRGLKKFLESPFKYEVEYEL* |
| Ga0211477_1000352414 | 3300020374 | Marine | MPKKTIKKKNIPNNFRGKEDIFFKKVRDGLKKFLESPFK |
| Ga0211705_101096593 | 3300020395 | Marine | KTSVRKNIVGNFRGSEDIFFIKVRDGLRKFLESPFK |
| Ga0211473_100311711 | 3300020451 | Marine | KRTRKRKNIDGNLRGSEDIFWIKVIKGLEKFLESPFR |
| Ga0211543_105080701 | 3300020470 | Marine | KRKKNIAGNFRGSEDIFWTKVVKGFKKFLEPPKWS |
| Ga0211579_100088614 | 3300020472 | Marine | MPKKTIKKKNIPNNFRGKEDLFFKKIRDGLKKFLESPFK |
| Ga0211547_102025383 | 3300020474 | Marine | MPKTKRKNIVGNFRGSEDIFWKKVRDGMKKFLEPAFKG |
| Ga0211585_100697412 | 3300020477 | Marine | MPKKTTKKKNIPNNFRGKEDLFFKKVRDGLKKFLESPFK |
| (restricted) Ga0255049_102916381 | 3300024517 | Seawater | MPRKKKNIPNNFRGEEDKFWSRIVKGLKKFLESPFK |
| Ga0208300_1022718 | 3300025061 | Marine | MPKKRAYKRKNIPNNFRGKEDRFWTKIVKGLKKFLESPFK |
| Ga0208920_10053863 | 3300025072 | Marine | MKKKTKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK |
| Ga0208298_10676731 | 3300025084 | Marine | KKKTKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK |
| Ga0208011_10012169 | 3300025096 | Marine | MKKLKKNIAGNFKGKEDIFWIKVKKGIKKFLEPAFKEK |
| Ga0208011_10163682 | 3300025096 | Marine | MPKKRKVRKNIPNNFRGKEDRFWTKVVKGLKSFLESPFK |
| Ga0208011_10295652 | 3300025096 | Marine | MPRKKNISNNFKGKEDIFWIKVKKGIKKFLEPAFKEK |
| Ga0208011_10457893 | 3300025096 | Marine | MPRRKRKKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK |
| Ga0208013_100131114 | 3300025103 | Marine | MKKRKNIPNNFRGKEDIFWIKIKKGIKKFLEPAFKEK |
| Ga0208013_10071139 | 3300025103 | Marine | MPTKRKPRKKNIQGNFRGAEDKFWSNVIKGFKKFLKSPFK |
| Ga0208013_10309412 | 3300025103 | Marine | MKKKTKKNIPNNFRGKEDKFWSNIVKGLKNFLQSPFK |
| Ga0208013_11099091 | 3300025103 | Marine | MKKLKKNIAGNFKGKEDIFWIKIKKGIKKFLEPAFKEK |
| Ga0208553_10060234 | 3300025109 | Marine | MKKKTKKNIPNNFRGKEDKFWSSIVKGLKNFLQSPFK |
| Ga0208553_10168232 | 3300025109 | Marine | MRRRKRKKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK |
| Ga0208553_10549011 | 3300025109 | Marine | MKKRKNIDGNFRGWEDIFFIKVKKGLKKFLESPFKGG |
| Ga0209349_10005999 | 3300025112 | Marine | MKKKKNIPNNFRGKEDKFWSNIVKGLKKFLESPFK |
| Ga0209349_10239973 | 3300025112 | Marine | MKKKTKKNIPNNFRGEEDKFWSNIVKGLKKFLQSPFK |
| Ga0208790_10860063 | 3300025118 | Marine | MKKKKKNIPNNFRGKEDLFWKKIADGLKVFLASPFKDNV |
| Ga0208790_11323741 | 3300025118 | Marine | RRRMKKKTKKNIPNNFRGKEDKFWSNIVKGLKNFLQSPFK |
| Ga0209644_10985433 | 3300025125 | Marine | MPRRKRRKNIPNNFRGKEDTFWKKVRDGLKQFLKSPFK |
| Ga0209232_12200671 | 3300025132 | Marine | KMPTKKTTKKKNIPNNFRGKEDLFFKKVRDGLKKFLESPFKXTRK |
| Ga0208299_10076444 | 3300025133 | Marine | MPKKKNIPHNLRGSEDLFWSKVIKGFKKFLTPAFKRKRQDK |
| Ga0209756_13239112 | 3300025141 | Marine | MPTKRKTKKKNIQGNFRGAEDKFWSNVIKGFKKFLESPFK |
| Ga0209645_10451422 | 3300025151 | Marine | MPTKRKPKKKNIQGNFRGAEDKFWSNVVKGFKKFLESPFK |
| Ga0209337_100057715 | 3300025168 | Marine | MPKRKNISNNFRGKEDIFWIKVKRGIKRFLEPAFKEK |
| Ga0209337_10051049 | 3300025168 | Marine | MAKRGRPRKNKPNNFRGSEDKFWSNVVKGLRKFLESPFK |
| Ga0209337_10400583 | 3300025168 | Marine | MTKRKKNINNNFRGAEDRFWKKVVNGLKKFLESPFK |
| Ga0209337_11536341 | 3300025168 | Marine | MTKRKKNINNNFRGAEDKFWKKVVNGLKKFLESPFK |
| Ga0207882_10288392 | 3300025218 | Deep Ocean | MKKRKNIDGNFRGWEDIFFTSIKKGLKKFLESPFKRTKK |
| Ga0208182_10077923 | 3300025251 | Deep Ocean | MKKRKNIDGNFRGWEDIFFIKIKKGLNKFFESPFKRGKK |
| Ga0207876_10402521 | 3300025259 | Deep Ocean | MKKRKNIDGNFRGWEDIFFISIKKGLKKFLESPFKRTKK |
| Ga0208113_10815841 | 3300026087 | Marine | RRVGFHTTARKNIPGNFRGAEDIFFIKISAGIKKFLESPFK |
| Ga0208317_10092881 | 3300026117 | Marine Oceanic | KKRKNIDGNFRGWEDIFFIKIKKGLNKFFESPFKRGKK |
| Ga0209709_101842511 | 3300027779 | Marine | MPRKKNISNNFKGKEDIFWIKVKKGIKKFFEPAFKDK |
| Ga0209501_100218171 | 3300027844 | Marine | MKKSKKNIPNNFRGEEDIFWTKIKKGIKKFLKPAFN |
| (restricted) Ga0233415_1000019130 | 3300027861 | Seawater | MKKSKKTGFTVNIPNNFRGKEDIFWIKIKKGIKKFLEPAFKEK |
| Ga0315329_105694923 | 3300032048 | Seawater | MKKSKKAGFTVKKNIPNNFRGKEDIFWTKIKKGIKKFLEPAFKEK |
| Ga0314858_033809_308_433 | 3300033742 | Sea-Ice Brine | MKMAKRGRPRKNKPNNFRGSEDKFWSNVVKGLRKFLESPFK |
| Ga0326741_020149_419_532 | 3300034654 | Filtered Seawater | MRRKKKTNIPNNFRGKEDIFWKKIKDGLKHFLKSPFK |
| Ga0326741_070169_49_159 | 3300034654 | Filtered Seawater | MPRKKKNIPNNFRGEEDKFWSKIVKGLKKFLKSPFK |
| ⦗Top⦘ |