


| Basic Information | |
|---|---|
| Family ID | F094392 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINKYKLNTNTNG |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 42.45 % |
| % of genes near scaffold ends (potentially truncated) | 8.49 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 43 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (50.000 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (85.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.057 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 1.89 |
| PF00856 | SET | 0.94 |
| PF00462 | Glutaredoxin | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.89 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.58 % |
| Unclassified | root | N/A | 26.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10023737 | All Organisms → Viruses → Predicted Viral | 2952 | Open in IMG/M |
| 3300001450|JGI24006J15134_10028376 | Not Available | 2484 | Open in IMG/M |
| 3300001450|JGI24006J15134_10028933 | All Organisms → Viruses → Predicted Viral | 2455 | Open in IMG/M |
| 3300001450|JGI24006J15134_10048222 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
| 3300001450|JGI24006J15134_10067090 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300001450|JGI24006J15134_10122825 | Not Available | 893 | Open in IMG/M |
| 3300001957|GOS2250_1006038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1370 | Open in IMG/M |
| 3300002488|JGI25128J35275_1004223 | All Organisms → Viruses → Predicted Viral | 4010 | Open in IMG/M |
| 3300002514|JGI25133J35611_10182362 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 559 | Open in IMG/M |
| 3300006164|Ga0075441_10248542 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 655 | Open in IMG/M |
| 3300006735|Ga0098038_1241593 | Not Available | 573 | Open in IMG/M |
| 3300006738|Ga0098035_1123786 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 890 | Open in IMG/M |
| 3300006738|Ga0098035_1251723 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 581 | Open in IMG/M |
| 3300006749|Ga0098042_1074446 | Not Available | 886 | Open in IMG/M |
| 3300006750|Ga0098058_1148631 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 620 | Open in IMG/M |
| 3300006751|Ga0098040_1072547 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1052 | Open in IMG/M |
| 3300006751|Ga0098040_1199622 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 584 | Open in IMG/M |
| 3300006752|Ga0098048_1074201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1045 | Open in IMG/M |
| 3300006752|Ga0098048_1094181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300006752|Ga0098048_1192995 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 602 | Open in IMG/M |
| 3300006752|Ga0098048_1196641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300006752|Ga0098048_1252040 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 516 | Open in IMG/M |
| 3300006753|Ga0098039_1287718 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 550 | Open in IMG/M |
| 3300006754|Ga0098044_1126684 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1034 | Open in IMG/M |
| 3300006754|Ga0098044_1232456 | Not Available | 718 | Open in IMG/M |
| 3300006754|Ga0098044_1287319 | Not Available | 631 | Open in IMG/M |
| 3300006754|Ga0098044_1360569 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 550 | Open in IMG/M |
| 3300006754|Ga0098044_1378247 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 534 | Open in IMG/M |
| 3300006789|Ga0098054_1137850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
| 3300006789|Ga0098054_1143623 | Not Available | 883 | Open in IMG/M |
| 3300006789|Ga0098054_1149118 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 864 | Open in IMG/M |
| 3300006789|Ga0098054_1199973 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 729 | Open in IMG/M |
| 3300006789|Ga0098054_1335278 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 538 | Open in IMG/M |
| 3300006793|Ga0098055_1101886 | Not Available | 1121 | Open in IMG/M |
| 3300006793|Ga0098055_1285105 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 618 | Open in IMG/M |
| 3300006793|Ga0098055_1325514 | Not Available | 573 | Open in IMG/M |
| 3300006793|Ga0098055_1387984 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 517 | Open in IMG/M |
| 3300006921|Ga0098060_1003153 | Not Available | 6124 | Open in IMG/M |
| 3300006921|Ga0098060_1018064 | All Organisms → Viruses → Predicted Viral | 2216 | Open in IMG/M |
| 3300006921|Ga0098060_1078267 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 950 | Open in IMG/M |
| 3300006921|Ga0098060_1122023 | Not Available | 731 | Open in IMG/M |
| 3300006921|Ga0098060_1151528 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 643 | Open in IMG/M |
| 3300006921|Ga0098060_1163109 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 615 | Open in IMG/M |
| 3300006922|Ga0098045_1029041 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300006922|Ga0098045_1043864 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1120 | Open in IMG/M |
| 3300006923|Ga0098053_1041702 | Not Available | 959 | Open in IMG/M |
| 3300006923|Ga0098053_1042729 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 946 | Open in IMG/M |
| 3300006924|Ga0098051_1145926 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 626 | Open in IMG/M |
| 3300006924|Ga0098051_1194036 | Not Available | 531 | Open in IMG/M |
| 3300006925|Ga0098050_1167215 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 551 | Open in IMG/M |
| 3300006927|Ga0098034_1213994 | Not Available | 536 | Open in IMG/M |
| 3300006928|Ga0098041_1027089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1867 | Open in IMG/M |
| 3300006928|Ga0098041_1074540 | Not Available | 1095 | Open in IMG/M |
| 3300006928|Ga0098041_1115466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 866 | Open in IMG/M |
| 3300006928|Ga0098041_1244905 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 572 | Open in IMG/M |
| 3300006928|Ga0098041_1256378 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 557 | Open in IMG/M |
| 3300006929|Ga0098036_1196845 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 612 | Open in IMG/M |
| 3300006929|Ga0098036_1249895 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 536 | Open in IMG/M |
| 3300006947|Ga0075444_10319859 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 595 | Open in IMG/M |
| 3300008050|Ga0098052_1283309 | Not Available | 628 | Open in IMG/M |
| 3300009512|Ga0115003_10602351 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 641 | Open in IMG/M |
| 3300009786|Ga0114999_10860856 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 665 | Open in IMG/M |
| 3300010149|Ga0098049_1193924 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 623 | Open in IMG/M |
| 3300010150|Ga0098056_1043548 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
| 3300010150|Ga0098056_1171368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300010151|Ga0098061_1174486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 770 | Open in IMG/M |
| 3300010151|Ga0098061_1184908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300010151|Ga0098061_1240757 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 632 | Open in IMG/M |
| 3300010151|Ga0098061_1246882 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 623 | Open in IMG/M |
| 3300010153|Ga0098059_1076756 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1334 | Open in IMG/M |
| 3300010153|Ga0098059_1193708 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 793 | Open in IMG/M |
| 3300010153|Ga0098059_1231240 | Not Available | 715 | Open in IMG/M |
| 3300010153|Ga0098059_1365728 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 546 | Open in IMG/M |
| 3300017720|Ga0181383_1080833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300017720|Ga0181383_1107346 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 750 | Open in IMG/M |
| 3300017732|Ga0181415_1082261 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 726 | Open in IMG/M |
| 3300017733|Ga0181426_1072895 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 684 | Open in IMG/M |
| 3300017748|Ga0181393_1157625 | Not Available | 563 | Open in IMG/M |
| 3300017757|Ga0181420_1116536 | Not Available | 815 | Open in IMG/M |
| 3300017757|Ga0181420_1184878 | Not Available | 610 | Open in IMG/M |
| 3300017782|Ga0181380_1223300 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 628 | Open in IMG/M |
| 3300025072|Ga0208920_1019641 | Not Available | 1463 | Open in IMG/M |
| 3300025096|Ga0208011_1105314 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 595 | Open in IMG/M |
| 3300025099|Ga0208669_1001295 | Not Available | 9257 | Open in IMG/M |
| 3300025099|Ga0208669_1002960 | All Organisms → cellular organisms → Bacteria | 5688 | Open in IMG/M |
| 3300025103|Ga0208013_1112194 | Not Available | 679 | Open in IMG/M |
| 3300025108|Ga0208793_1190499 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 519 | Open in IMG/M |
| 3300025110|Ga0208158_1013070 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
| 3300025118|Ga0208790_1196741 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 533 | Open in IMG/M |
| 3300025128|Ga0208919_1157703 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 700 | Open in IMG/M |
| 3300025128|Ga0208919_1221731 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 559 | Open in IMG/M |
| 3300025128|Ga0208919_1225683 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 552 | Open in IMG/M |
| 3300025132|Ga0209232_1021052 | All Organisms → Viruses → Predicted Viral | 2562 | Open in IMG/M |
| 3300025133|Ga0208299_1242952 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 511 | Open in IMG/M |
| 3300025137|Ga0209336_10185195 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 523 | Open in IMG/M |
| 3300025138|Ga0209634_1071953 | All Organisms → Viruses → Predicted Viral | 1621 | Open in IMG/M |
| 3300025138|Ga0209634_1121412 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1114 | Open in IMG/M |
| 3300025141|Ga0209756_1081493 | Not Available | 1449 | Open in IMG/M |
| 3300025168|Ga0209337_1046136 | Not Available | 2292 | Open in IMG/M |
| 3300025168|Ga0209337_1050248 | Not Available | 2168 | Open in IMG/M |
| 3300025168|Ga0209337_1102683 | Not Available | 1328 | Open in IMG/M |
| 3300025168|Ga0209337_1192641 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 837 | Open in IMG/M |
| 3300025168|Ga0209337_1313823 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 559 | Open in IMG/M |
| 3300031851|Ga0315320_10027957 | All Organisms → Viruses → Predicted Viral | 4466 | Open in IMG/M |
| 3300033742|Ga0314858_168109 | Not Available | 564 | Open in IMG/M |
| 3300034656|Ga0326748_052854 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 85.85% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.89% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.94% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.94% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100237373 | 3300000116 | Marine | MKEIDQKLDQWIYNSIIRAEIRALIVKETNKHKINTNTNG* |
| JGI24006J15134_100283767 | 3300001450 | Marine | MKEIDQKLDQWIYSPIIRAEIRVLIVKEINKYKINTNTNG* |
| JGI24006J15134_100289332 | 3300001450 | Marine | MKEIDQKLDQWIYNSIIRAEIRALIVKEINKYKLNTNANG* |
| JGI24006J15134_100482223 | 3300001450 | Marine | MKEIDQMLDQWIYNSIIRAKIRALIVKYKQNTNKAG* |
| JGI24006J15134_100670904 | 3300001450 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKQNTNTNG* |
| JGI24006J15134_101228253 | 3300001450 | Marine | MKEIDEKLDQWIYNSKIRAEIRVLIVKEINKYKQNTNKDG* |
| GOS2250_10060382 | 3300001957 | Marine | MKEIDDLLKQWIPVNTIIRAKIRAAIVKEINKYKLNTNKDG* |
| JGI25128J35275_10042238 | 3300002488 | Marine | MKEIDNMLEQWIKNSIIRAKFRKIIVKEINKYKQNTNAIG* |
| JGI25133J35611_101823621 | 3300002514 | Marine | VKEIDQKLEQWIYNSIIRAEIRAAIVKEINKYKLNTNEDG* |
| Ga0075441_102485422 | 3300006164 | Marine | MKEIDQKLDQWIYNSIIRAEIRVLIVKEINKYKLNTNQNG* |
| Ga0098038_12415932 | 3300006735 | Marine | MREIDNWLNQWVKNSIIRERFRNIILKEINKYKPNTNTNG* |
| Ga0098035_11237863 | 3300006738 | Marine | MKEIDRLLKQWIPVNTIIREEIRAAIVKEINKYKINTNTNGYYN* |
| Ga0098035_12517232 | 3300006738 | Marine | MKEIDRLLKQWIPVNTVIREEIRNAIVKEINKYKLNTNTNG* |
| Ga0098042_10744464 | 3300006749 | Marine | MKEIDQMLDQWIFNTVIRAKFRKIIVKEINKYKLNTNSIG* |
| Ga0098058_11486312 | 3300006750 | Marine | MKEIDRLLEQWIPVNTIVREEIRAAIVKEINKYKINTNTNG* |
| Ga0098040_10725472 | 3300006751 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIIKEINKYKLNTNEDG* |
| Ga0098040_11996222 | 3300006751 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNTNG* |
| Ga0098048_10742013 | 3300006752 | Marine | MKEIDRLLKQWIPVNTIIREEIRNAIVKEINKYKLNTNTNG* |
| Ga0098048_10941812 | 3300006752 | Marine | MKEIDQMLDQWIFNTIIRKKLRDLIIKEINKYKQNTNTNG* |
| Ga0098048_11929952 | 3300006752 | Marine | MKEIDDMLDTWVFNTIIRAKFREIIVKEIDKHRLNTNTKR* |
| Ga0098048_11966412 | 3300006752 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINKHKQNTNTKG* |
| Ga0098048_12520403 | 3300006752 | Marine | MKEIDQKLKQWIHSNVIRAEIRALIVKEINKYKLNTNTNG* |
| Ga0098039_12877183 | 3300006753 | Marine | MKEIDILLKRWIPVNTIIREEVRNAIVKEINKYKLNTNTNG* |
| Ga0098044_11266843 | 3300006754 | Marine | MKEIDRLLEQWIPVNTIVREEIRAAIVKEINKYKINTNANG* |
| Ga0098044_12324562 | 3300006754 | Marine | MKEIDILLKRWIPVNTIIRAEIRAAIVKEINKYKLNTNKDG* |
| Ga0098044_12873192 | 3300006754 | Marine | MKEIDILLKKWIPVNTIIREEVRNAIVKEINKYKINTNKDG* |
| Ga0098044_13605691 | 3300006754 | Marine | KNNMREIDQMLEQWIKNTIIRAKFREVIVKEINKYKQNTNTNG* |
| Ga0098044_13782472 | 3300006754 | Marine | MKEINQMLEQWIHNTIIRERFRKIIVKEINKYKLNTNTNG* |
| Ga0098054_11378501 | 3300006789 | Marine | MKEIDRLLKQWIPVNTIIREEIREAIVKEINKYKLNTNTNG* |
| Ga0098054_11436232 | 3300006789 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINKYKQNTNTNG* |
| Ga0098054_11491182 | 3300006789 | Marine | MKEIDQMLEQWVKNTIIRTKFREIIVKEIDKYKSNTNTKG* |
| Ga0098054_11999733 | 3300006789 | Marine | MKEIDQMLEQWVKNSIIRKKFRKIILKEINKYKQNT |
| Ga0098054_13352781 | 3300006789 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINNHKLNTTYYR* |
| Ga0098055_11018862 | 3300006793 | Marine | MKEIDQMLEQWVKNSIIRKKFRKIILKEINKYKQNTNTNG* |
| Ga0098055_12851052 | 3300006793 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNEDG* |
| Ga0098055_13255142 | 3300006793 | Marine | MKEIDQMLEQWVHNTIIRERFRKIIVKEINKYKLNTNKDG* |
| Ga0098055_13879842 | 3300006793 | Marine | MKEIDQMLEQWIKNTIIRAKFREVIVKEINKYKQNTNTNG* |
| Ga0098060_10031538 | 3300006921 | Marine | MKEIDQMLEQWIKNTIIRAKFREVIVKEIDKYKLNTNTNG* |
| Ga0098060_10180647 | 3300006921 | Marine | MKEIDQMLEQWVRNTIIREKFRKIIVKEINKYKTNTNKDG* |
| Ga0098060_10782671 | 3300006921 | Marine | MKEIDNWLNQWVKNSIIRERFRKIILKEINKYKLNTN |
| Ga0098060_11220233 | 3300006921 | Marine | MKEIDQKLNQWIYNSIIRAEIRELIVKEINKYKLNTNTNG* |
| Ga0098060_11515282 | 3300006921 | Marine | MKEIDQMLDQWIKNTIIRAKFRKVIIKEINKYKQNTNTNG* |
| Ga0098060_11631093 | 3300006921 | Marine | MKEIDRLLEQWIPVNTIIREEIRAAIVKEINKYKINTNKDG* |
| Ga0098045_10290411 | 3300006922 | Marine | IDQMLDQWIKNTIIKAKFRKVIVKEINKYKQNTNTNG* |
| Ga0098045_10438642 | 3300006922 | Marine | MREIDQMLDQWIKNTIIKAKFREIIVKEIDKYKINTNKDG* |
| Ga0098053_10417021 | 3300006923 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNKEG* |
| Ga0098053_10427294 | 3300006923 | Marine | MKEIDRLLKQWIPVNTIIREEIRAAIVKEINKYKINTNANG* |
| Ga0098051_11459261 | 3300006924 | Marine | MKEIDRLLEQWIPVNTIVREEIRAAIVKEINKYKLNTNANG* |
| Ga0098051_11940362 | 3300006924 | Marine | MKEIDQMLEQWIHNTIIRERFRKIIVKEKNKHKQNTNKKG* |
| Ga0098050_11672152 | 3300006925 | Marine | MKEIDQMLEQWIKNTIIRAKFREVIVKEINKYKLNTNKDG* |
| Ga0098034_12139942 | 3300006927 | Marine | MKEIDNMLDTWIRNSIIRNKLRELIVKEIDKYKQNTNTIG* |
| Ga0098041_10270896 | 3300006928 | Marine | MKEIDQMLDQWIKNTIIKAKFREIIVKEIDKYKINTNEDG* |
| Ga0098041_10745403 | 3300006928 | Marine | MKEIDQMLDQWIFNTVIRAKFRKIIVKEINKYKLNTNTIG* |
| Ga0098041_11154663 | 3300006928 | Marine | MKEIDQMLEQWVKNSIIREKFRKIILKEINKYKQNTNTNG* |
| Ga0098041_12449052 | 3300006928 | Marine | MKEIDQMLEQWVKNGIIREKFRKIILKEINKYKQNTNTKG* |
| Ga0098041_12563782 | 3300006928 | Marine | MREIDQMLEQWIKNTIIRAKFREIIVKEIDKHRLNTNTKR* |
| Ga0098036_11968453 | 3300006929 | Marine | MKEIDRLLKQWIPVNTIIKEEIRAAIVKEINKYKINTNANG* |
| Ga0098036_12498952 | 3300006929 | Marine | MKEIDNWLNQWVKNSIIRERFRKIILKEINKYKLNTNTNG* |
| Ga0075444_103198592 | 3300006947 | Marine | MKEIDILLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNTNG* |
| Ga0098052_12833092 | 3300008050 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINKYKQNTNDDG* |
| Ga0115003_106023511 | 3300009512 | Marine | MKEIDRLLKQWIPVNTIIRAEIRTAIVKEIDKYKLNTNTNG* |
| Ga0114999_108608562 | 3300009786 | Marine | MEEIDQKLDQWIYNSIIRAEIRELIVKEINKYKLNTNQNG* |
| Ga0098049_11939243 | 3300010149 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKINTNTNG* |
| Ga0098056_10435482 | 3300010150 | Marine | MKEIDRLLEMWIPVNTIIRAEIREAIVKEINKYKNIKK* |
| Ga0098056_11713682 | 3300010150 | Marine | MKEIYRLLEQWIPVNTIIRAEIRAAIVKEINKYKQNTNTNG* |
| Ga0098061_11744863 | 3300010151 | Marine | MKEIDQMLEQWVKNSIIREKFRKIILKEINKYKQNTNTKG* |
| Ga0098061_11849082 | 3300010151 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINKYKLNTNTNG* |
| Ga0098061_12407573 | 3300010151 | Marine | MKEIDRLLEQWIPVNTIIRAEIRTAIVKEINKYKLNTNTNG* |
| Ga0098061_12468822 | 3300010151 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIVKEINNHKLNTTYYR* |
| Ga0098059_10767561 | 3300010153 | Marine | MKEIDQMLEQWVKNSIIRKKFRKIILKEINKYKQNTNVNG* |
| Ga0098059_11937081 | 3300010153 | Marine | MKEIDQMLDQWIKNTIIRAKFREVIVKEINKYKQNTNTNG* |
| Ga0098059_12312401 | 3300010153 | Marine | MREIDQMLDQWVKNTIIRAKFREIIVKEIDKYELTPNTNG* |
| Ga0098059_13657282 | 3300010153 | Marine | MEEIDRLLKQWIPVNTIIREEIRAAIVKEINKYKINTNANG* |
| Ga0181383_10808332 | 3300017720 | Seawater | MKEIDQMLDQWIKNTIIRAKFRKVIVKEINKYKQNTISIG |
| Ga0181383_11073462 | 3300017720 | Seawater | MKEIDQMLDQWIKNTIIKAKFREVIVKEIDKYKLNTNTNR |
| Ga0181415_10822612 | 3300017732 | Seawater | MKEIDQMLDQWIKNTIIRAKFRKVIVKEINKYKQNTNTNG |
| Ga0181426_10728951 | 3300017733 | Seawater | MKEIDQMLDQWIKNTIIKAKFREIIVKEINKHKQNTNTNG |
| Ga0181393_11576251 | 3300017748 | Seawater | EIDQKLKQWIHSNVIRAEIRVLIVKEINKYKLNTNTNG |
| Ga0181420_11165361 | 3300017757 | Seawater | MKEIDQMLEQWIHNTIIRERFRKIIVKEINKYKLNTNTNG |
| Ga0181420_11848782 | 3300017757 | Seawater | MKEIDQMLDQWIKNTIIRAKFRKIIVKEIDKYKLNTNKDG |
| Ga0181380_12233002 | 3300017782 | Seawater | MKEIDQMLDQWIKNTIIKAKFREVIVKEIDKYKLNTNTNG |
| Ga0208920_10196413 | 3300025072 | Marine | MKEIDRLLKQWIPVNTIIREEIRAAIVKEINKYKINTNTNG |
| Ga0208011_11053142 | 3300025096 | Marine | MKEIDRLLEQWIPVNTIIRAEIRAAIIKEINKYKLNTNEDG |
| Ga0208669_100129513 | 3300025099 | Marine | MKEIDQMLEQWIKNTIIRAKFREVIVKEIDKYKLNTNTNG |
| Ga0208669_10029604 | 3300025099 | Marine | MKEIDQMLEQWVRNTIIREKFRKIIVKEINKYKTNTNKDG |
| Ga0208013_11121942 | 3300025103 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNKEG |
| Ga0208793_11904992 | 3300025108 | Marine | MKEIDRLLEQWIPVNTIIREEIRAAIVKEINKYKLNTNKNG |
| Ga0208158_10130708 | 3300025110 | Marine | MKEIDQMLDQWIKNTIIKAKFREIIVKEIDKYKINTNKDG |
| Ga0208790_11967412 | 3300025118 | Marine | MKEIDRLLEQWIPVNTIVREEIRAAIVKEINKYKINTNANG |
| Ga0208919_11577032 | 3300025128 | Marine | MKEIDNWLNQWVKNSIIRERFRKIILKEINKYKLNTNTNG |
| Ga0208919_12217312 | 3300025128 | Marine | MKEIDQMLDQWIKNTIIKAKFREVIVKEIDKYKLNTNKDG |
| Ga0208919_12256832 | 3300025128 | Marine | MKEIDILLKQWIPVNTIIREEIRNAIVKEINKYKLNTNEDG |
| Ga0209232_10210523 | 3300025132 | Marine | MKEIDNMLEQWIKNSIIRAKFRKIIVKEINKYKQNTNAIG |
| Ga0208299_12429522 | 3300025133 | Marine | MKEIDRLLEQWIPVNTIIRAEIRTAIVKEINKYKLNTNANG |
| Ga0209336_101851951 | 3300025137 | Marine | MKEIDQKLDQWIYSPIIRAEIRVLIVKEINKYKINTNTNG |
| Ga0209634_10719534 | 3300025138 | Marine | MEEIDQKLDQWIYNSIIRAEIRELIVKEINKYKLNTNQNG |
| Ga0209634_11214122 | 3300025138 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKQNTNTNG |
| Ga0209756_10814934 | 3300025141 | Marine | VKEIDQKLEQWIYNSIIRAEIRALIVKEINKYKLNTNEDG |
| Ga0209337_10461363 | 3300025168 | Marine | MEKIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKQNTNTNG |
| Ga0209337_10502483 | 3300025168 | Marine | MKEIDQKLDQWIYNSIIRAEIRALIVKEINKYKLNTNTNG |
| Ga0209337_11026832 | 3300025168 | Marine | MKEIDQKLDQWIHSPIIRAEIRVLIVKEINKYKLNTNTNG |
| Ga0209337_11926413 | 3300025168 | Marine | MKEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKLNTNKDG |
| Ga0209337_13138232 | 3300025168 | Marine | MEEIDRLLKQWIPVNTIIRAEIRAAIVKEINKYKNK |
| Ga0315320_1002795710 | 3300031851 | Seawater | MKEIDQKLKQLIHSNVIRAEIRALIVKEINKYKLNTNTNG |
| Ga0314858_168109_333_455 | 3300033742 | Sea-Ice Brine | MKEIDEKLDQWIYNSKIRAEIRVLIVKEINKYKQNTNKDG |
| Ga0326748_052854_457_573 | 3300034656 | Filtered Seawater | EIDQKLDQWIYNSIIRAEIKALIVKEINKYKLNTNEDG |
| ⦗Top⦘ |