


| Basic Information | |
|---|---|
| Family ID | F094361 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 49 residues |
| Representative Sequence | TMRARNPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 94.34 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (15.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.679 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF06754 | PhnG | 68.87 |
| PF05845 | PhnH | 7.55 |
| PF00459 | Inositol_P | 3.77 |
| PF05861 | PhnI | 2.83 |
| PF12974 | Phosphonate-bd | 0.94 |
| PF00795 | CN_hydrolase | 0.94 |
| PF00999 | Na_H_Exchanger | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3624 | Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG | Inorganic ion transport and metabolism [P] | 68.87 |
| COG3625 | Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH | Inorganic ion transport and metabolism [P] | 7.55 |
| COG3626 | Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI | Inorganic ion transport and metabolism [P] | 2.83 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.94 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.94 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.94 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.11 % |
| Unclassified | root | N/A | 1.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101117870 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300000955|JGI1027J12803_100990999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300004633|Ga0066395_10146375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1192 | Open in IMG/M |
| 3300005176|Ga0066679_10030088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2982 | Open in IMG/M |
| 3300005330|Ga0070690_101389802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300005330|Ga0070690_101530153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300005355|Ga0070671_101681566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005444|Ga0070694_100924685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005445|Ga0070708_100871969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 845 | Open in IMG/M |
| 3300005468|Ga0070707_101447935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300005536|Ga0070697_100463295 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005536|Ga0070697_100774207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 848 | Open in IMG/M |
| 3300005536|Ga0070697_101192768 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005546|Ga0070696_102011133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300005618|Ga0068864_101026117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300005713|Ga0066905_101039064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 724 | Open in IMG/M |
| 3300005713|Ga0066905_101388222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300005713|Ga0066905_102008865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300005764|Ga0066903_102968397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300005764|Ga0066903_103738174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300005764|Ga0066903_103824305 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005764|Ga0066903_106554313 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005764|Ga0066903_108215457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300005843|Ga0068860_101868781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300005844|Ga0068862_100970718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 839 | Open in IMG/M |
| 3300005985|Ga0081539_10407057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300006169|Ga0082029_1543761 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300006844|Ga0075428_102733555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300006844|Ga0075428_102743270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300006853|Ga0075420_101385040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300006854|Ga0075425_100277391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1929 | Open in IMG/M |
| 3300006871|Ga0075434_100816440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300006871|Ga0075434_102417877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300006880|Ga0075429_101181989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300006914|Ga0075436_100633040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300009131|Ga0115027_11851441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300009147|Ga0114129_13302344 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009162|Ga0075423_12172467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300009171|Ga0105101_10573169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300010043|Ga0126380_11190754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 656 | Open in IMG/M |
| 3300010043|Ga0126380_11799774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300010046|Ga0126384_10304631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300010046|Ga0126384_10428906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300010046|Ga0126384_12112519 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010047|Ga0126382_12034831 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010358|Ga0126370_10760953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalbus → Thioalbus denitrificans | 859 | Open in IMG/M |
| 3300010358|Ga0126370_11426243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300010359|Ga0126376_10668100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
| 3300010360|Ga0126372_13314806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300010362|Ga0126377_13263458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300010376|Ga0126381_103085152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300010376|Ga0126381_104407896 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010401|Ga0134121_10946352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300010401|Ga0134121_11547218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300011436|Ga0137458_1229647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300012361|Ga0137360_10330622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300012912|Ga0157306_10414864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300012927|Ga0137416_11830826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300012931|Ga0153915_13602989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012948|Ga0126375_10639514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 819 | Open in IMG/M |
| 3300012948|Ga0126375_11773037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300013306|Ga0163162_12196111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300017944|Ga0187786_10205220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 752 | Open in IMG/M |
| 3300018422|Ga0190265_10032145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 4376 | Open in IMG/M |
| 3300021344|Ga0193719_10405571 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021420|Ga0210394_11370769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300021560|Ga0126371_12906721 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025931|Ga0207644_11567092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300025933|Ga0207706_11695363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300026075|Ga0207708_11823074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300026118|Ga0207675_102191219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300026482|Ga0257172_1065305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300027703|Ga0207862_1031724 | Not Available | 1588 | Open in IMG/M |
| 3300027873|Ga0209814_10156138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300027874|Ga0209465_10123138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300027874|Ga0209465_10384402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300027909|Ga0209382_10000333 | All Organisms → cellular organisms → Bacteria | 76358 | Open in IMG/M |
| 3300027909|Ga0209382_11012152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10651406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300028380|Ga0268265_11146667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300028380|Ga0268265_12635903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300031545|Ga0318541_10540732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300031679|Ga0318561_10834701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300031719|Ga0306917_10898329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300031720|Ga0307469_10259318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1405 | Open in IMG/M |
| 3300031740|Ga0307468_100923231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 759 | Open in IMG/M |
| 3300031740|Ga0307468_101633798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300031942|Ga0310916_10622608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 916 | Open in IMG/M |
| 3300031944|Ga0310884_10494867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300031946|Ga0310910_11550435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300032000|Ga0310903_10737251 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032075|Ga0310890_10034795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2754 | Open in IMG/M |
| 3300032174|Ga0307470_10185847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1312 | Open in IMG/M |
| 3300032180|Ga0307471_100654930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1213 | Open in IMG/M |
| 3300032180|Ga0307471_101585526 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 811 | Open in IMG/M |
| 3300032180|Ga0307471_102079936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300032180|Ga0307471_102522716 | Not Available | 651 | Open in IMG/M |
| 3300032180|Ga0307471_103236095 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032180|Ga0307471_103341335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300032205|Ga0307472_101548084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300032770|Ga0335085_10773474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300032782|Ga0335082_10173550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2068 | Open in IMG/M |
| 3300032829|Ga0335070_10003690 | All Organisms → cellular organisms → Bacteria | 17923 | Open in IMG/M |
| 3300033004|Ga0335084_11798518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300033485|Ga0316626_10997056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300033811|Ga0364924_064050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.94% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1011178701 | 3300000364 | Soil | KEIGAWLGNFVPADDAKYNVIRELNETAKRLKAQK* |
| JGI1027J12803_1009909991 | 3300000955 | Soil | LKSAIQESLVSMKSRSPETFKEVGATVGGFVAADDTKYQVVRDLNETAKRLKAQK* |
| Ga0066395_101463753 | 3300004633 | Tropical Forest Soil | SFKSAIQESLTTMRARNPEAFKEIGAWLGGFVPADDGKYQVIRDLNETAKKLAAQK* |
| Ga0066679_100300885 | 3300005176 | Soil | MPASLRSAVTESLTTMKARHPDVFKEIGAWVGGFVPADDGKYQVIRELNETAKRLKATQK |
| Ga0070690_1013898021 | 3300005330 | Switchgrass Rhizosphere | EAFKEIGAWVGNFVVADDGKYQVIRELNETAKKLAAQKQ* |
| Ga0070690_1015301531 | 3300005330 | Switchgrass Rhizosphere | SLVSMKSRNPETFKDIGAWVGGFVPADDTKYQVIRDLNETAKRLKAAK* |
| Ga0070671_1016815662 | 3300005355 | Switchgrass Rhizosphere | ESLTTMRARNPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK* |
| Ga0070694_1009246851 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LTTMRARNPEAFKEAGATIGGFVPADDGKYQVIRDLNETAKRLAAQK* |
| Ga0070708_1008719693 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ESLTTMKARNPEVFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK* |
| Ga0070707_1014479351 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PEAFKEIGAWIGNFVVADDGKYQVIRELNETAKRLAAQK* |
| Ga0070697_1004632953 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VVRKDLPANLRQAVQESPITMRGRNPEAFKEIGAWVGGFVKADDSKYQVIRELNDTAKKLAAQK* |
| Ga0070697_1007742073 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TTMKARNPEVFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK* |
| Ga0070697_1011927681 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKARNPEAFKEVGAWLSGFVAADDSKYQVIRDLNDTSKKLAAKK* |
| Ga0070696_1020111331 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AIQESLTTMRARNPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK* |
| Ga0068864_1010261173 | 3300005618 | Switchgrass Rhizosphere | IVVRKDMPPSLRSAIQESLTTMRARNPEIFREAGATVGGFVLADDGKYQVIRDLNETAKRLAAQK* |
| Ga0066905_1010390641 | 3300005713 | Tropical Forest Soil | NPEAFKEIGAWLGNFVPADDGKYQVIRDLNETAKKLAAQK* |
| Ga0066905_1013882221 | 3300005713 | Tropical Forest Soil | LTTMKVRHPEAFKEIGAWVGGFVPADDGKYQVVRELDDVAKKLAAAKK* |
| Ga0066905_1020088652 | 3300005713 | Tropical Forest Soil | ASLKSAIQESLTTMKARHPETFKEIGAWLGGFVPADDSKYQVVRELDDVAKKLAAKK* |
| Ga0066903_1029683971 | 3300005764 | Tropical Forest Soil | PSFKQAVQESLVSMKARNPEAFKEIGAWVGNFVKADDSKYQVIRDLNETAKRLAAQK* |
| Ga0066903_1037381742 | 3300005764 | Tropical Forest Soil | LSMKAKNPEAFKEVGAWLGGFVRADDAKYQVIRELNETARRLASQQ* |
| Ga0066903_1038243053 | 3300005764 | Tropical Forest Soil | LPASLKSAIQESLVSMREKNPDAFKEMGTSLSGFVSADDTKYQVIRELNETAKKLAAAK* |
| Ga0066903_1065543131 | 3300005764 | Tropical Forest Soil | PSLKSAIQESLVSMKAKNPEAFKEIGAWLSGFVPADDGKYQVIRELNDTAKKLAAQK* |
| Ga0066903_1082154571 | 3300005764 | Tropical Forest Soil | KDLPPSFKQAVQESLISMKARNPEAFKEIGVWVGNFVKADDSKYQVIRDLNETAKRLAAQK* |
| Ga0068860_1018687811 | 3300005843 | Switchgrass Rhizosphere | MRARNTEAFKEIGAWLGGFVPADDGKYQVIRDLNETAKRLAAQK* |
| Ga0068862_1009707181 | 3300005844 | Switchgrass Rhizosphere | KEIGAWLGGFVPADDGKYQVIRDLNETAKRLAAQK* |
| Ga0081539_104070572 | 3300005985 | Tabebuia Heterophylla Rhizosphere | PASLRSAITESLTTMKARNPEAFKEIGAWVGNFVPADDAKYQVIRDLNDVAKKLAAQK* |
| Ga0082029_15437611 | 3300006169 | Termite Nest | EIGAWLGGFVAADDGKYQVIRDLNDTAKKLKAQK* |
| Ga0075428_1027335551 | 3300006844 | Populus Rhizosphere | ESLTTMRARNPEAFKEIGAWVGNFVVADDGKYQVIRDLNETAKKLAAQK* |
| Ga0075428_1027432701 | 3300006844 | Populus Rhizosphere | ESLTTMRARNPEAFKEIGAWVGNFVVADDGKYQVIRDLNDTAKKLAAQK* |
| Ga0075420_1013850403 | 3300006853 | Populus Rhizosphere | LPPSLKAAVQESLLSMRAKNPDVFKEIGAWLGGFVKADDAKYQVIRELNETAKALKSKS* |
| Ga0075425_1002773911 | 3300006854 | Populus Rhizosphere | NPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAVQK* |
| Ga0075434_1008164403 | 3300006871 | Populus Rhizosphere | NPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK* |
| Ga0075434_1024178772 | 3300006871 | Populus Rhizosphere | LPASLRSAIQESLVSMKDRNPDVFKEIGAWLGGFVPADDGKYQVIRDLNDTAKKLAAQK* |
| Ga0075429_1011819892 | 3300006880 | Populus Rhizosphere | LTMRARDPEAFKEIGAWLGGFVKADDAKYQVIRDLNETAKALKAKK* |
| Ga0075436_1006330401 | 3300006914 | Populus Rhizosphere | NPETFKELGAWVGNFVPADDAKYNVIRELNETAKRLKAQK* |
| Ga0115027_118514411 | 3300009131 | Wetland | RVAHHHEARNPETFKEIGAWLGGFVPADDGKYQVIRELNDVAKKLAAQK* |
| Ga0114129_133023441 | 3300009147 | Populus Rhizosphere | EAFKEIGAWLSGFVAADDSKYQVIRDLNDAAKKLAAQK* |
| Ga0075423_121724671 | 3300009162 | Populus Rhizosphere | IVVRKDLSASLKGAIQESLLSMRARDPDAFKEIGAWLGGFVKADDAKYQVIRDLNETAKALKAKQ* |
| Ga0105101_105731691 | 3300009171 | Freshwater Sediment | PASLRSAITESLTTMKARNPEVFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK* |
| Ga0126380_111907543 | 3300010043 | Tropical Forest Soil | SLISMKVRNPDAFKEIGVWVGNFVKADDSKYQVIRDLNETAKRLAAQK* |
| Ga0126380_117997742 | 3300010043 | Tropical Forest Soil | MKSRSPETFKEVGATVGGFVVADDSKYQVIRDLNETAKKLAAQK* |
| Ga0126384_103046311 | 3300010046 | Tropical Forest Soil | PDAFKEIGAWLSGFVAADDGKYQVIRELNDTAKKLAAQK* |
| Ga0126384_104289064 | 3300010046 | Tropical Forest Soil | SLKSAIQESLVSMKAKNPEAFKEIGAWLSGFVPADDGKYQVIRELNDTAKKLAAQKQ* |
| Ga0126384_121125193 | 3300010046 | Tropical Forest Soil | RNPEAFKEIGVWVGNFVKADDSKYQVIRDLNETAKRLAAQK* |
| Ga0126382_120348311 | 3300010047 | Tropical Forest Soil | LVSMKARNPEAFKEIGAWVGNFVKADDSKYQVIRDLNETAKRLAAQK* |
| Ga0126370_107609533 | 3300010358 | Tropical Forest Soil | KNPDAFKEIGAWLSGFVAADDGKYQVIRELNDTAKKLAAQK* |
| Ga0126370_114262431 | 3300010358 | Tropical Forest Soil | DAFKEIGAWVGNFVRADDAKYQVVRELNDAAKKLAAQK* |
| Ga0126376_106681001 | 3300010359 | Tropical Forest Soil | VSMKAKNPEAFKEIGAWLSGFVPADDGKYQVIRELNDTAKKLAAQKQ* |
| Ga0126372_133148061 | 3300010360 | Tropical Forest Soil | SLKAAIQESLVSMKSRSPETFKEVGATVGGFVVADDSKYQVIRDLNETAKKLKAQK* |
| Ga0126377_132634581 | 3300010362 | Tropical Forest Soil | MRTRNTEAFKEIGAWLGGFVPADDGKYQVIRDLNETAKRLAAQK* |
| Ga0126381_1030851521 | 3300010376 | Tropical Forest Soil | DLPASFKSAIQESLTTMRARNPEAFREIGAWLGGFVPADDGKYQVIRDLNETAKKLAAQK |
| Ga0126381_1044078961 | 3300010376 | Tropical Forest Soil | IQESLVSMKAKNPDAFKEIGAWLSGFVAADDGKYQVIRELNDTAKKLAAQK* |
| Ga0134121_109463521 | 3300010401 | Terrestrial Soil | FKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK* |
| Ga0134121_115472182 | 3300010401 | Terrestrial Soil | SAITESLTTMKARNPEVFKEIGAWLGGFVPADDGKYQVVRDLNDVAKKLAAQK* |
| Ga0137458_12296471 | 3300011436 | Soil | ARNPEVFKEAGATIGGFVPADDGKYQVIRDLNETAKRLAAQK* |
| Ga0137360_103306222 | 3300012361 | Vadose Zone Soil | MKARNPEVFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK* |
| Ga0157306_104148641 | 3300012912 | Soil | PVVVRKDLPPTLRAAIQESLVSMKSRNPEAFKEIGAWIGNFVSADDAKYQVIRDLNETAKRLKAAK* |
| Ga0137416_118308262 | 3300012927 | Vadose Zone Soil | RSAVTESLTTMKARHPDVFKEIGAWVGGFVPADDGKYQVIRELNETAKRLKAQK* |
| Ga0153915_136029891 | 3300012931 | Freshwater Wetlands | AFKEIGAWVGNFVPADDGKYQVIRELNGVAKKLAAQK* |
| Ga0126375_106395143 | 3300012948 | Tropical Forest Soil | VAESLTTMKSRHPDAFKEIGAWVGNFVPADDGKYQVIRDLNETAKKLAAQK* |
| Ga0126375_117730371 | 3300012948 | Tropical Forest Soil | RRDMPASLRAAVVESLTTMKARQPDTFREIGAWVGNFVPADDTKYNVIRELNETAKRLKAQK* |
| Ga0163162_121961111 | 3300013306 | Switchgrass Rhizosphere | MKGKPEVFKEVGAWLGGFVRADDAKYKVIRDLNETAEALKAAK* |
| Ga0187786_102052203 | 3300017944 | Tropical Peatland | SAITESLTTMKARSPETFKEIGAWVGGFVPADDAKYQVVRDLNDVARKLAAQK |
| Ga0190265_100321457 | 3300018422 | Soil | ASLRSAITESLTTMKARNPEAFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK |
| Ga0193719_104055713 | 3300021344 | Soil | SRNPEAFKEIGAWVGNFVPADDAKYQVIRDLNETAKRLKAAK |
| Ga0210394_113707691 | 3300021420 | Soil | VRKDMPASLRSAIQESLTTMKARSPETFKEIGAWVGGFVPADDAKYQVIRDLNDVAKKLAAQK |
| Ga0126371_129067213 | 3300021560 | Tropical Forest Soil | SLVSMKAKNPEAFKEIGAWLSGFVPADDGKYQVIRELNDTAKKLAAQK |
| Ga0207644_115670922 | 3300025931 | Switchgrass Rhizosphere | TMRARNPEAFKEIGAWVGNFVAADDGKYQVIRDLNETAKKLAAQK |
| Ga0207706_116953632 | 3300025933 | Corn Rhizosphere | PPTLKAAVQESLLSMKGKPEVFKEVGAWLGGFVRADDAKYQVIRDLNETAKALKAAK |
| Ga0207708_118230743 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKAAVQESLLSMKGKPEVFKEVGAWLGGFVRADDAKYQVIRDLNETAKALKAAK |
| Ga0207675_1021912191 | 3300026118 | Switchgrass Rhizosphere | FKEIGAWIGNFVSADDAKYQVIRDLNETAKRLKAAK |
| Ga0257172_10653052 | 3300026482 | Soil | SLRSAITESLTTMKARNPEGFKEIGAWLGGFVPADDGKYQVIRDLNDVAKKLAAQK |
| Ga0207862_10317241 | 3300027703 | Tropical Forest Soil | ARKPEAFVQAGAWVGAFVKADDSKYQIIRDLNDTAKKLAAQKN |
| Ga0209814_101561383 | 3300027873 | Populus Rhizosphere | RRDMPASLRSAVVESLTTMKTRNPEAFKEIGAWLGNFVPADDAKYSVIRELNETAKRLKAQK |
| Ga0209465_101231383 | 3300027874 | Tropical Forest Soil | MKAKNPEAFKEIGAWLSGFVPADDGKYQVIRELNDTAKKLAAQK |
| Ga0209465_103844021 | 3300027874 | Tropical Forest Soil | DLPASFKSAIQESLTTMRARNPEAFKEIGAWLGGFVPADDGKYQVIRDLNETAKKLAAQK |
| Ga0209382_100003331 | 3300027909 | Populus Rhizosphere | EAFKEIGAWVGNFVVADDGKYQVIRDLNETAKKLAAQK |
| Ga0209382_110121521 | 3300027909 | Populus Rhizosphere | LKQALQESMLTMRARDPEAFKEIGAWLGGFVRADDAKYQVIRDLNETAKALKAKK |
| (restricted) Ga0233417_106514062 | 3300028043 | Sediment | VVRKDMPASLRSAITESLITMKTRNPEVFKEIGAWLGGFVPADDGKYQVIRDLNDVAKRLAAQK |
| Ga0268265_111466673 | 3300028380 | Switchgrass Rhizosphere | KEIGAWLGGFVPADDGKYQVIRDLNETAKRLAAQK |
| Ga0268265_126359033 | 3300028380 | Switchgrass Rhizosphere | ESLVSMKSRSPETFKEVGATVGGFVAADDGKYQVVRDLNETAKRLKAQK |
| Ga0318541_105407321 | 3300031545 | Soil | FKEIGAWLGGFVPADDGKYQVIRDLNETAKKLAAQK |
| Ga0318561_108347012 | 3300031679 | Soil | LVSMKAKNPDAFKEIGAWLSGFVAADDGKYQVIRELNDTAKKLAAQK |
| Ga0306917_108983293 | 3300031719 | Soil | ESLTTMRSRNPEAFKEIGAWLGNFVVADDSKYQVIRDLNETAKKLAAQK |
| Ga0307469_102593181 | 3300031720 | Hardwood Forest Soil | TMRARNPETFKEIGAWLGGFVVADDGKYQVIRDLNETAKKLAAQKSGG |
| Ga0307468_1009232311 | 3300031740 | Hardwood Forest Soil | ANLRQAVQESLVTMRARNPEALREIGAWVGGFVKADDGKYQVIREMNDTAKKLAAQK |
| Ga0307468_1016337982 | 3300031740 | Hardwood Forest Soil | IVVRKDLPASLRSAITESLTSMKARNPDVFKEIGAWLGGFVPADDGKYQVIRDLNDVARKLAAQK |
| Ga0310916_106226083 | 3300031942 | Soil | IVVRKDLPASFKSAIQESLTTMRARNPEAFKEIGAWLGGFVPADDGKYQVIRDLNETAKKLAAQK |
| Ga0310884_104948671 | 3300031944 | Soil | LRAAIQESLVSMKSRNPEAFKEIGAWIGNFVSADDAKYQVIRDLNETAKRLKAAK |
| Ga0310910_115504352 | 3300031946 | Soil | MKAKNPDAFKEIGAWLSGFVAADDGKYQVIRELNDTAKKLAAQK |
| Ga0310903_107372513 | 3300032000 | Soil | MKSRNPEAFKEIGAWIGNFVSADDAKYQVIRDLNETAKRLKAAK |
| Ga0310890_100347956 | 3300032075 | Soil | SLISMKSRNPEAFKEIGAWIGNFVSADDAKYQVIRDLNETAKRLKAAK |
| Ga0307470_101858474 | 3300032174 | Hardwood Forest Soil | LTTMKARNPEAFKEIGAWLGGFVPADDAKYQVIRELNDVSKKLAAQK |
| Ga0307471_1006549303 | 3300032180 | Hardwood Forest Soil | RSAITESLTTMKARNPEVFKEIGAWLGGFVPADDGKYQVIRDLNEVSKKLAAQK |
| Ga0307471_1015855261 | 3300032180 | Hardwood Forest Soil | MRARNPEAFAQIGAWVGAFVKADDGKYQVVRDLNDTAKKLATPK |
| Ga0307471_1020799363 | 3300032180 | Hardwood Forest Soil | FKEIGAWLGNFVKADDSKYQVIRDLNETAKRLAAQK |
| Ga0307471_1025227163 | 3300032180 | Hardwood Forest Soil | PEVFKEAGATIGGFVPADDGKYQVIRDLNETAKRLAAQK |
| Ga0307471_1032360951 | 3300032180 | Hardwood Forest Soil | MKSRSPETFKDVGATVGGFVAADDGKYQVIRELNETAKRLKAQK |
| Ga0307471_1033413352 | 3300032180 | Hardwood Forest Soil | EVFTEAGATIGGFVPADDGKYQVIRDLNETAKRLAAQK |
| Ga0307472_1015480843 | 3300032205 | Hardwood Forest Soil | AFKEIGAWLGGFVPADDSKYQVIRDLNETAKRLAAQK |
| Ga0335085_107734744 | 3300032770 | Soil | QESLVSMKAKNPEAFKEIGAWLSGFVAADDSKYQVIRELNETAKKLAAQK |
| Ga0335082_101735504 | 3300032782 | Soil | LTTMKARSPETFKEIGAWLGGFVAADDAKYQVIRELNETSKKLAAQK |
| Ga0335070_1000369021 | 3300032829 | Soil | ASLRSAITESLTTMKARSPETFKEIGAWLGGFVAADDAKYQVIRELNETSKKLAAQK |
| Ga0335084_117985181 | 3300033004 | Soil | ETFKEIGAWVGGFVAADDGKYQVIRDLNETAKRLKAQK |
| Ga0316626_109970563 | 3300033485 | Soil | SRHPEAFNDIGAWVGRFVTADDAKYQVIRELNETAKRLKAAK |
| Ga0364924_064050_3_167 | 3300033811 | Sediment | KSAIQESLTTMRARKPEAFKEIGAWVGNFVTADDSKYQVIRELNETSKRLAAQK |
| ⦗Top⦘ |