


| Basic Information | |
|---|---|
| Family ID | F094325 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.32 % |
| % of genes near scaffold ends (potentially truncated) | 60.38 % |
| % of genes from short scaffolds (< 2000 bps) | 92.45 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.755 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.245 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.113 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 6.60 |
| PF06439 | 3keto-disac_hyd | 6.60 |
| PF13472 | Lipase_GDSL_2 | 2.83 |
| PF03401 | TctC | 1.89 |
| PF04248 | NTP_transf_9 | 1.89 |
| PF03459 | TOBE | 1.89 |
| PF00072 | Response_reg | 0.94 |
| PF00497 | SBP_bac_3 | 0.94 |
| PF04392 | ABC_sub_bind | 0.94 |
| PF12071 | DUF3551 | 0.94 |
| PF04055 | Radical_SAM | 0.94 |
| PF13565 | HTH_32 | 0.94 |
| PF00872 | Transposase_mut | 0.94 |
| PF00144 | Beta-lactamase | 0.94 |
| PF02265 | S1-P1_nuclease | 0.94 |
| PF00580 | UvrD-helicase | 0.94 |
| PF01610 | DDE_Tnp_ISL3 | 0.94 |
| PF04311 | DUF459 | 0.94 |
| PF07883 | Cupin_2 | 0.94 |
| PF13367 | PrsW-protease | 0.94 |
| PF02769 | AIRS_C | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 6.60 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 1.89 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.89 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.94 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.94 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.94 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.94 |
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.94 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.94 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.75 % |
| Unclassified | root | N/A | 29.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100577334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1002279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2716 | Open in IMG/M |
| 3300002909|JGI25388J43891_1066659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300002910|JGI25615J43890_1095152 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005332|Ga0066388_102715254 | Not Available | 904 | Open in IMG/M |
| 3300005468|Ga0070707_100732958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300005471|Ga0070698_101483043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300005553|Ga0066695_10532889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300005562|Ga0058697_10609692 | Not Available | 571 | Open in IMG/M |
| 3300005616|Ga0068852_100073530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3007 | Open in IMG/M |
| 3300005618|Ga0068864_100600620 | Not Available | 1068 | Open in IMG/M |
| 3300005713|Ga0066905_100195630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1506 | Open in IMG/M |
| 3300005764|Ga0066903_101079618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300005764|Ga0066903_101914442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1136 | Open in IMG/M |
| 3300005764|Ga0066903_104659898 | Not Available | 730 | Open in IMG/M |
| 3300005764|Ga0066903_106554259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005764|Ga0066903_106670978 | Not Available | 600 | Open in IMG/M |
| 3300005764|Ga0066903_108125393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300006028|Ga0070717_10729656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300006038|Ga0075365_11061616 | Not Available | 570 | Open in IMG/M |
| 3300006172|Ga0075018_10654419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300006573|Ga0074055_10011012 | Not Available | 867 | Open in IMG/M |
| 3300006904|Ga0075424_100146997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2496 | Open in IMG/M |
| 3300006914|Ga0075436_100335087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300007255|Ga0099791_10002737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7159 | Open in IMG/M |
| 3300009088|Ga0099830_10050101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2943 | Open in IMG/M |
| 3300009090|Ga0099827_10280762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1405 | Open in IMG/M |
| 3300009137|Ga0066709_101250723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300009148|Ga0105243_12259528 | Not Available | 581 | Open in IMG/M |
| 3300009162|Ga0075423_11561521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300009176|Ga0105242_11254863 | Not Available | 763 | Open in IMG/M |
| 3300009792|Ga0126374_10068631 | Not Available | 1886 | Open in IMG/M |
| 3300009792|Ga0126374_10549265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300010043|Ga0126380_11757016 | Not Available | 559 | Open in IMG/M |
| 3300010046|Ga0126384_10684385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300010359|Ga0126376_10204177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1640 | Open in IMG/M |
| 3300010360|Ga0126372_11004138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 846 | Open in IMG/M |
| 3300010366|Ga0126379_10395442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1428 | Open in IMG/M |
| 3300010366|Ga0126379_10536335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300010366|Ga0126379_11463129 | Not Available | 789 | Open in IMG/M |
| 3300010373|Ga0134128_13081479 | Not Available | 512 | Open in IMG/M |
| 3300010376|Ga0126381_102612267 | Not Available | 723 | Open in IMG/M |
| 3300010376|Ga0126381_103360863 | Not Available | 630 | Open in IMG/M |
| 3300010398|Ga0126383_10747079 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1059 | Open in IMG/M |
| 3300010398|Ga0126383_13523382 | Not Available | 511 | Open in IMG/M |
| 3300011106|Ga0151489_1604134 | Not Available | 673 | Open in IMG/M |
| 3300012180|Ga0153974_1051166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 907 | Open in IMG/M |
| 3300012198|Ga0137364_10579815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
| 3300012201|Ga0137365_10857275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300012208|Ga0137376_10310207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1369 | Open in IMG/M |
| 3300012349|Ga0137387_10892183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300012361|Ga0137360_10618822 | Not Available | 927 | Open in IMG/M |
| 3300012917|Ga0137395_10157785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
| 3300012929|Ga0137404_12053033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300012929|Ga0137404_12142746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300012955|Ga0164298_11599883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300012960|Ga0164301_10773014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300012976|Ga0134076_10036604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1810 | Open in IMG/M |
| 3300014325|Ga0163163_12418695 | Not Available | 584 | Open in IMG/M |
| 3300014969|Ga0157376_13107095 | Not Available | 503 | Open in IMG/M |
| 3300015264|Ga0137403_10559758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300015371|Ga0132258_10653778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2643 | Open in IMG/M |
| 3300015371|Ga0132258_11543135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1677 | Open in IMG/M |
| 3300016422|Ga0182039_11164406 | Not Available | 696 | Open in IMG/M |
| 3300016445|Ga0182038_11397943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300018468|Ga0066662_11762363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300021078|Ga0210381_10404285 | Not Available | 505 | Open in IMG/M |
| 3300021444|Ga0213878_10181426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300021560|Ga0126371_12462069 | Not Available | 630 | Open in IMG/M |
| 3300022530|Ga0242658_1123457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300022531|Ga0242660_1230460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300022533|Ga0242662_10330278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300022726|Ga0242654_10384368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300025910|Ga0207684_10023821 | All Organisms → cellular organisms → Bacteria | 5224 | Open in IMG/M |
| 3300025910|Ga0207684_10182593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1809 | Open in IMG/M |
| 3300025920|Ga0207649_11586390 | Not Available | 518 | Open in IMG/M |
| 3300025931|Ga0207644_10082951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2372 | Open in IMG/M |
| 3300026095|Ga0207676_11014286 | Not Available | 818 | Open in IMG/M |
| 3300027061|Ga0209729_1041354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 582 | Open in IMG/M |
| 3300027502|Ga0209622_1091863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300027654|Ga0209799_1010585 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300027846|Ga0209180_10449830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300027903|Ga0209488_10332121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1132 | Open in IMG/M |
| 3300027909|Ga0209382_12117925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300028592|Ga0247822_10737332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 799 | Open in IMG/M |
| 3300028711|Ga0307293_10019772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1971 | Open in IMG/M |
| 3300028768|Ga0307280_10034176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
| 3300028811|Ga0307292_10194094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 832 | Open in IMG/M |
| 3300028824|Ga0307310_10442214 | Not Available | 650 | Open in IMG/M |
| 3300028878|Ga0307278_10379088 | Not Available | 622 | Open in IMG/M |
| 3300031226|Ga0307497_10076817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1245 | Open in IMG/M |
| 3300031545|Ga0318541_10268440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300031765|Ga0318554_10119019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1490 | Open in IMG/M |
| 3300031777|Ga0318543_10157036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300031777|Ga0318543_10283668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300031782|Ga0318552_10357039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300031832|Ga0318499_10082648 | Not Available | 1232 | Open in IMG/M |
| 3300031947|Ga0310909_11021839 | Not Available | 674 | Open in IMG/M |
| 3300032008|Ga0318562_10260244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300032055|Ga0318575_10405351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300032059|Ga0318533_10820349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300032067|Ga0318524_10747336 | Not Available | 516 | Open in IMG/M |
| 3300032174|Ga0307470_10332148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300032180|Ga0307471_100384635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1525 | Open in IMG/M |
| 3300032261|Ga0306920_102889999 | Not Available | 651 | Open in IMG/M |
| 3300033290|Ga0318519_10911496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.94% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1005773343 | 3300000364 | Soil | MLWVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY* |
| AP72_2010_repI_A100DRAFT_10022791 | 3300000837 | Forest Soil | LRIRPPLTLGWEVEMSERRITQLFGPIPGAIVSCTMVLNAFAF* |
| JGI25388J43891_10666592 | 3300002909 | Grasslands Soil | GYNQSQRMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| JGI25615J43890_10951521 | 3300002910 | Grasslands Soil | VQPTQRMAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF* |
| Ga0066388_1027152542 | 3300005332 | Tropical Forest Soil | MRQMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY* |
| Ga0070707_1007329582 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0070698_1014830432 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0066695_105328891 | 3300005553 | Soil | ALERRLAMSERKITQLFGLILGALFTCTLVLNAFAF* |
| Ga0058697_106096922 | 3300005562 | Agave | MLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY* |
| Ga0068852_1000735301 | 3300005616 | Corn Rhizosphere | SVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0068864_1006006201 | 3300005618 | Switchgrass Rhizosphere | LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0066905_1001956301 | 3300005713 | Tropical Forest Soil | MGVLDMSERRITQLFGLILGALVTCTLVLNAFAF* |
| Ga0066903_1010796183 | 3300005764 | Tropical Forest Soil | MLAHATNVRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY* |
| Ga0066903_1019144423 | 3300005764 | Tropical Forest Soil | MREIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF* |
| Ga0066903_1046598981 | 3300005764 | Tropical Forest Soil | MLYRQEGAMSERRITQVFGLALGAIFTCALVLNAFAY* |
| Ga0066903_1065542592 | 3300005764 | Tropical Forest Soil | LGWEIEMSERRITQLFGLVLGAIVTCTLVLNAFAF* |
| Ga0066903_1066709782 | 3300005764 | Tropical Forest Soil | TNQRDRELTMTERRITRLVGLALGALFTCGLILNAFAF* |
| Ga0066903_1081253931 | 3300005764 | Tropical Forest Soil | RLGWEVEMSERRITQLFGLVLGAIVTCTLVLNAFAF* |
| Ga0070717_107296561 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0075365_110616161 | 3300006038 | Populus Endosphere | VLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0075018_106544191 | 3300006172 | Watersheds | GWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0074055_100110122 | 3300006573 | Soil | NRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0075424_1001469974 | 3300006904 | Populus Rhizosphere | LEREAEMSERRITQLFGLILGALFTCTLVLNAFAF* |
| Ga0075436_1003350872 | 3300006914 | Populus Rhizosphere | MANRLGWELEMSERRITQVFGLVLGAITTCTMVLNAFAF* |
| Ga0099791_100027374 | 3300007255 | Vadose Zone Soil | MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF* |
| Ga0099830_100501015 | 3300009088 | Vadose Zone Soil | MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNALAF* |
| Ga0099827_102807622 | 3300009090 | Vadose Zone Soil | MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF* |
| Ga0066709_1012507232 | 3300009137 | Grasslands Soil | MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0105243_122595282 | 3300009148 | Miscanthus Rhizosphere | TNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0075423_115615212 | 3300009162 | Populus Rhizosphere | MANRLGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF* |
| Ga0105242_112548632 | 3300009176 | Miscanthus Rhizosphere | RVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0126374_100686311 | 3300009792 | Tropical Forest Soil | MRNAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF* |
| Ga0126374_105492652 | 3300009792 | Tropical Forest Soil | MANRLGWEMEMSERRITQLFGLGLGAIITCTMILNAFAF* |
| Ga0126380_117570162 | 3300010043 | Tropical Forest Soil | VKSGRLEMSERRITQLFGLILGALFTCTLVLNAFAF* |
| Ga0126384_106843853 | 3300010046 | Tropical Forest Soil | GGTSQPQMMDMSERRITQLFGLVLGAIVTCTLVLNAFAF* |
| Ga0126376_102041771 | 3300010359 | Tropical Forest Soil | MANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF* |
| Ga0126372_110041382 | 3300010360 | Tropical Forest Soil | VGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF* |
| Ga0126379_103954424 | 3300010366 | Tropical Forest Soil | SVCGYNQSQRMANRLGWEMEMSERRITQLFGLGLGAIITCTMVLNAFAF* |
| Ga0126379_105363353 | 3300010366 | Tropical Forest Soil | FRVLEGAMSERRITQWFGLILGAIFTFGLVLNAFAF* |
| Ga0126379_114631292 | 3300010366 | Tropical Forest Soil | RLVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF* |
| Ga0134128_130814791 | 3300010373 | Terrestrial Soil | PTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0126381_1026122672 | 3300010376 | Tropical Forest Soil | KKGERDMSERKITQLFGLILGVLFACTLVLNVFAF* |
| Ga0126381_1033608631 | 3300010376 | Tropical Forest Soil | RKIFRAQVGRLDMTERRITQLFGLALGAIVTCTLVLNAFAF* |
| Ga0126383_107470792 | 3300010398 | Tropical Forest Soil | VVGRLDMTERRITQLFGLILGGMVTCTLVLNAFAF* |
| Ga0126383_135233821 | 3300010398 | Tropical Forest Soil | MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0151489_16041341 | 3300011106 | Soil | MLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0153974_10511661 | 3300012180 | Attine Ant Fungus Gardens | MANHLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0137364_105798151 | 3300012198 | Vadose Zone Soil | RPMLRVLEGDMSERRITQLFGLILGGIFTCTLVLSAFAY* |
| Ga0137365_108572752 | 3300012201 | Vadose Zone Soil | RATKVKDGRLDMSERKITQLFGLILGALFTCTLVLNAFAF* |
| Ga0137376_103102073 | 3300012208 | Vadose Zone Soil | MAIRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF* |
| Ga0137387_108921832 | 3300012349 | Vadose Zone Soil | MPIRLGWELEISERPITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0137360_106188222 | 3300012361 | Vadose Zone Soil | IARATKVKDGRLEMSERRITQWFGLILGALFTCTLVLNAFAF* |
| Ga0137395_101577853 | 3300012917 | Vadose Zone Soil | MAGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0137404_120530331 | 3300012929 | Vadose Zone Soil | RLGWEVEMTERRITQLFGLTLGAMVTCTLVLNAFAF* |
| Ga0137404_121427462 | 3300012929 | Vadose Zone Soil | MEWGAIMSERQITRLFGLILGAVLTCGLILNAFAF* |
| Ga0164298_115998832 | 3300012955 | Soil | MANRLGWEVEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0164301_107730142 | 3300012960 | Soil | MANDWVGSWKMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0134076_100366044 | 3300012976 | Grasslands Soil | FKWELDMSERKITQLFGLILGILFACTLVLNAFAF* |
| Ga0163163_124186951 | 3300014325 | Switchgrass Rhizosphere | RSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0157376_131070951 | 3300014969 | Miscanthus Rhizosphere | TNGVVRPTNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0137403_105597581 | 3300015264 | Vadose Zone Soil | MAGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF* |
| Ga0132258_106537781 | 3300015371 | Arabidopsis Rhizosphere | DRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF* |
| Ga0132258_115431353 | 3300015371 | Arabidopsis Rhizosphere | MANRLGWELEMSERRITQVFGLVLGAIITCTMVLNAFAF* |
| Ga0182039_111644062 | 3300016422 | Soil | MRGAAAEMSERKITQLFGLILGALFTCALILNAFAS |
| Ga0182038_113979431 | 3300016445 | Soil | MANRWVWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0066662_117623632 | 3300018468 | Grasslands Soil | RMAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0210381_104042851 | 3300021078 | Groundwater Sediment | FDRLIVWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0213878_101814262 | 3300021444 | Bulk Soil | MANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0126371_124620691 | 3300021560 | Tropical Forest Soil | MRKIFRAQVGRLDMTERRITQLFGLVLGAIVTCTLVLNAFAF |
| Ga0242658_11234571 | 3300022530 | Soil | DWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0242660_12304602 | 3300022531 | Soil | LGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0242662_103302782 | 3300022533 | Soil | ANHLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0242654_103843681 | 3300022726 | Soil | NDWVGSWKMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0207684_100238217 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0207684_101825933 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0207649_115863902 | 3300025920 | Corn Rhizosphere | LIVRWLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0207644_100829513 | 3300025931 | Switchgrass Rhizosphere | TNGVVRPTNHSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0207676_110142861 | 3300026095 | Switchgrass Rhizosphere | LIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0209729_10413542 | 3300027061 | Forest Soil | MANRLGWKLKMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0209622_10918632 | 3300027502 | Forest Soil | MANRLGWELKMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0209799_10105852 | 3300027654 | Tropical Forest Soil | MVGTLDMSERRITQLFGLVLGAMVTCTLVLNAFAF |
| Ga0209180_104498302 | 3300027846 | Vadose Zone Soil | MAGWEVEMSERRITQLFGLGLGAIITCTMVLNALAF |
| Ga0209488_103321212 | 3300027903 | Vadose Zone Soil | SGLFDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0209382_121179252 | 3300027909 | Populus Rhizosphere | NLRVLEGAMSERRITQLFGLILGAIFTFGLVLNAFAF |
| Ga0247822_107373321 | 3300028592 | Soil | RATNRSVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307293_100197721 | 3300028711 | Soil | LLDRLIVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307280_100341763 | 3300028768 | Soil | PSGLFDRLIIWVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307292_101940942 | 3300028811 | Soil | VRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307310_104422141 | 3300028824 | Soil | PTNGTVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307278_103790881 | 3300028878 | Soil | IVRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0307497_100768171 | 3300031226 | Soil | FDRLIIRVLEGDMSERRITQLFGLILGGLFTFGLVLNAFAF |
| Ga0318541_102684402 | 3300031545 | Soil | MASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0318554_101190191 | 3300031765 | Soil | VQQPQNLVGRLDMSERRITQLFGLVLGAMVTCTLVLNAFAF |
| Ga0318543_101570362 | 3300031777 | Soil | RMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0318543_102836681 | 3300031777 | Soil | VQVGRLDMSERRITQLFGLILGAIVTCTLVLNAFAF |
| Ga0318552_103570391 | 3300031782 | Soil | TQRMASRLGWELEMSERRITQLFGLVLGAIITCTMVLNAFAF |
| Ga0318499_100826481 | 3300031832 | Soil | QRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0310909_110218391 | 3300031947 | Soil | SARCAAEISERKITQLFGLILGALFTCTLILNAFAF |
| Ga0318562_102602443 | 3300032008 | Soil | VQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0318575_104053512 | 3300032055 | Soil | RLRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0318533_108203491 | 3300032059 | Soil | RVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0318524_107473362 | 3300032067 | Soil | RMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0307470_103321481 | 3300032174 | Hardwood Forest Soil | MAGWEVEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| Ga0307471_1003846353 | 3300032180 | Hardwood Forest Soil | VIKFSGQVREAEMTERRITQLFGLILGALFTGTLILNAFAF |
| Ga0306920_1028899992 | 3300032261 | Soil | GNMVWRLDMTERRITQLFGLILGAIVTCTLVLNAFAF |
| Ga0318519_109114961 | 3300033290 | Soil | LRVQPTQRMANRLGWELEMSERRITQLFGLGLGAIITCTMVLNAFAF |
| ⦗Top⦘ |