


| Basic Information | |
|---|---|
| Family ID | F094307 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENK |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.39 % |
| % of genes near scaffold ends (potentially truncated) | 95.28 % |
| % of genes from short scaffolds (< 2000 bps) | 82.08 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.302 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (32.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.075 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.604 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 0.00% Coil/Unstructured: 82.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01230 | HIT | 6.60 |
| PF00528 | BPD_transp_1 | 5.66 |
| PF13559 | DUF4129 | 3.77 |
| PF13735 | tRNA_NucTran2_2 | 3.77 |
| PF00005 | ABC_tran | 3.77 |
| PF00203 | Ribosomal_S19 | 3.77 |
| PF03780 | Asp23 | 3.77 |
| PF00814 | TsaD | 3.77 |
| PF00682 | HMGL-like | 2.83 |
| PF02686 | Glu-tRNAGln | 2.83 |
| PF00572 | Ribosomal_L13 | 2.83 |
| PF16697 | Yop-YscD_cpl | 1.89 |
| PF04055 | Radical_SAM | 1.89 |
| PF00899 | ThiF | 1.89 |
| PF01209 | Ubie_methyltran | 1.89 |
| PF02441 | Flavoprotein | 1.89 |
| PF10128 | OpcA_G6PD_assem | 1.89 |
| PF00890 | FAD_binding_2 | 1.89 |
| PF00208 | ELFV_dehydrog | 1.89 |
| PF01148 | CTP_transf_1 | 1.89 |
| PF00420 | Oxidored_q2 | 1.89 |
| PF01597 | GCV_H | 0.94 |
| PF00496 | SBP_bac_5 | 0.94 |
| PF01979 | Amidohydro_1 | 0.94 |
| PF13489 | Methyltransf_23 | 0.94 |
| PF00175 | NAD_binding_1 | 0.94 |
| PF01523 | PmbA_TldD | 0.94 |
| PF02621 | VitK2_biosynth | 0.94 |
| PF00909 | Ammonium_transp | 0.94 |
| PF02771 | Acyl-CoA_dh_N | 0.94 |
| PF05746 | DALR_1 | 0.94 |
| PF00313 | CSD | 0.94 |
| PF03721 | UDPG_MGDP_dh_N | 0.94 |
| PF08022 | FAD_binding_8 | 0.94 |
| PF02594 | DUF167 | 0.94 |
| PF12849 | PBP_like_2 | 0.94 |
| PF00338 | Ribosomal_S10 | 0.94 |
| PF00498 | FHA | 0.94 |
| PF00348 | polyprenyl_synt | 0.94 |
| PF02645 | DegV | 0.94 |
| PF08352 | oligo_HPY | 0.94 |
| PF02786 | CPSase_L_D2 | 0.94 |
| PF11946 | DUF3463 | 0.94 |
| PF00483 | NTP_transferase | 0.94 |
| PF00171 | Aldedh | 0.94 |
| PF02882 | THF_DHG_CYH_C | 0.94 |
| PF03466 | LysR_substrate | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0185 | Ribosomal protein S19 | Translation, ribosomal structure and biogenesis [J] | 3.77 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 3.77 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 3.77 |
| COG1302 | Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) family | Function unknown [S] | 3.77 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0721 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit | Translation, ribosomal structure and biogenesis [J] | 2.83 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.89 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.89 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.89 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 1.89 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.94 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0051 | Ribosomal protein S10 | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.94 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.94 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.94 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.94 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.94 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.94 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.94 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.94 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.94 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.94 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.30 % |
| Unclassified | root | N/A | 21.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000880|AL20A1W_1283790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300001536|A1565W1_10462852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300004156|Ga0062589_101489075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300005166|Ga0066674_10197191 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005179|Ga0066684_10461517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 854 | Open in IMG/M |
| 3300005181|Ga0066678_10256326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300005345|Ga0070692_10057124 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300005468|Ga0070707_100164582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2161 | Open in IMG/M |
| 3300005518|Ga0070699_100019289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5869 | Open in IMG/M |
| 3300005539|Ga0068853_101470054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300005540|Ga0066697_10536407 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005554|Ga0066661_10679063 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006031|Ga0066651_10277107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300006173|Ga0070716_100206913 | Not Available | 1308 | Open in IMG/M |
| 3300007255|Ga0099791_10424077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300007258|Ga0099793_10076215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1523 | Open in IMG/M |
| 3300009012|Ga0066710_100047284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5276 | Open in IMG/M |
| 3300009012|Ga0066710_101097875 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300009029|Ga0066793_10006247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6071 | Open in IMG/M |
| 3300009090|Ga0099827_10002143 | All Organisms → cellular organisms → Bacteria | 10775 | Open in IMG/M |
| 3300009090|Ga0099827_10054898 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
| 3300009090|Ga0099827_10749883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300009090|Ga0099827_11202562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300010040|Ga0126308_10782394 | Not Available | 660 | Open in IMG/M |
| 3300010106|Ga0127472_1127421 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010147|Ga0126319_1253339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300010335|Ga0134063_10521024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 597 | Open in IMG/M |
| 3300010335|Ga0134063_10617572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300010337|Ga0134062_10469509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300010399|Ga0134127_12424964 | Not Available | 604 | Open in IMG/M |
| 3300011107|Ga0151490_1810139 | Not Available | 547 | Open in IMG/M |
| 3300012010|Ga0120118_1005119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4089 | Open in IMG/M |
| 3300012201|Ga0137365_11149186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300012203|Ga0137399_10087265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2384 | Open in IMG/M |
| 3300012206|Ga0137380_11352914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300012206|Ga0137380_11623991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300012208|Ga0137376_10372924 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300012209|Ga0137379_10574049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_70_10 | 1035 | Open in IMG/M |
| 3300012209|Ga0137379_10684620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 931 | Open in IMG/M |
| 3300012211|Ga0137377_11473320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300012350|Ga0137372_10415578 | Not Available | 1016 | Open in IMG/M |
| 3300012351|Ga0137386_10994778 | Not Available | 597 | Open in IMG/M |
| 3300012353|Ga0137367_10306797 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300012356|Ga0137371_11115679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300012356|Ga0137371_11129468 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012356|Ga0137371_11417636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300012357|Ga0137384_10102050 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
| 3300012359|Ga0137385_10556357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300012359|Ga0137385_11283133 | Not Available | 595 | Open in IMG/M |
| 3300012376|Ga0134032_1069320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300012381|Ga0134026_1239202 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012532|Ga0137373_10341982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1177 | Open in IMG/M |
| 3300012922|Ga0137394_11581609 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012922|Ga0137394_11612689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 505 | Open in IMG/M |
| 3300012927|Ga0137416_10125349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1973 | Open in IMG/M |
| 3300012955|Ga0164298_10685371 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012961|Ga0164302_10117553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1505 | Open in IMG/M |
| 3300015359|Ga0134085_10549546 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017792|Ga0163161_10657191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
| 3300018056|Ga0184623_10316055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300018066|Ga0184617_1007478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2056 | Open in IMG/M |
| 3300018066|Ga0184617_1223709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300019878|Ga0193715_1079916 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300020022|Ga0193733_1081392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 908 | Open in IMG/M |
| 3300021073|Ga0210378_10320941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300021344|Ga0193719_10000540 | All Organisms → cellular organisms → Bacteria | 14384 | Open in IMG/M |
| 3300022756|Ga0222622_10907951 | Not Available | 646 | Open in IMG/M |
| 3300025899|Ga0207642_10118784 | Not Available | 1360 | Open in IMG/M |
| 3300026306|Ga0209468_1149369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 614 | Open in IMG/M |
| 3300026312|Ga0209153_1058669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300026313|Ga0209761_1310564 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026315|Ga0209686_1169505 | Not Available | 623 | Open in IMG/M |
| 3300026326|Ga0209801_1242146 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027561|Ga0209887_1040316 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300028704|Ga0307321_1073546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300028708|Ga0307295_10191040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300028709|Ga0307279_10022786 | Not Available | 876 | Open in IMG/M |
| 3300028715|Ga0307313_10051293 | Not Available | 1209 | Open in IMG/M |
| 3300028717|Ga0307298_10255493 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300028718|Ga0307307_10030400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1532 | Open in IMG/M |
| 3300028718|Ga0307307_10252156 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300028721|Ga0307315_10228117 | Not Available | 581 | Open in IMG/M |
| 3300028744|Ga0307318_10135457 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300028755|Ga0307316_10029123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1796 | Open in IMG/M |
| 3300028768|Ga0307280_10057043 | Not Available | 1232 | Open in IMG/M |
| 3300028771|Ga0307320_10151733 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300028784|Ga0307282_10293762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300028787|Ga0307323_10290292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300028787|Ga0307323_10325397 | Not Available | 551 | Open in IMG/M |
| 3300028791|Ga0307290_10060112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1375 | Open in IMG/M |
| 3300028799|Ga0307284_10138365 | Not Available | 933 | Open in IMG/M |
| 3300028803|Ga0307281_10185972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
| 3300028807|Ga0307305_10164254 | Not Available | 1024 | Open in IMG/M |
| 3300028807|Ga0307305_10344893 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300028811|Ga0307292_10225448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300028819|Ga0307296_10486135 | Not Available | 675 | Open in IMG/M |
| 3300028828|Ga0307312_10030404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3142 | Open in IMG/M |
| 3300028878|Ga0307278_10386479 | Not Available | 615 | Open in IMG/M |
| 3300028881|Ga0307277_10010089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3635 | Open in IMG/M |
| 3300028881|Ga0307277_10027326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2258 | Open in IMG/M |
| 3300028885|Ga0307304_10593848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300031226|Ga0307497_10560472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 32.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL20A1W_12837901 | 3300000880 | Permafrost | MSVAYLRFAPPVRETMFPSRVPFFSDRLSPRAAEIAAW |
| A1565W1_104628521 | 3300001536 | Permafrost | MSVAYLRFAPPVRETMFPSRVPFFSDRLSPRAAEIAA |
| Ga0062589_1014890752 | 3300004156 | Soil | MSVARLRLVPVRETMFRSRAPFFRCGLSPRAAEIAAWAEEEE |
| Ga0066674_101971912 | 3300005166 | Soil | MNVVRLRLAPVRETMFPSRAPFFKDRLSPRAAEIAAWAEESKRGNL |
| Ga0066684_104615173 | 3300005179 | Soil | MSVARFQLAPVRETMFPSRAPFFRERFGLRAAAIAARAED |
| Ga0066678_102563262 | 3300005181 | Soil | MSVARLRLAHVGETMFPPRTPSFMCRLSPRAAEIAACAEENT |
| Ga0070692_100571241 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGRLRLASVRETMFPSRAPFFRDRLNPRAAEIAAWAEE |
| Ga0070707_1001645821 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENE |
| Ga0070699_1000192891 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVARLRLAPVRETMFPSRAPFLRDRLSARGVATAAANAEEKE |
| Ga0068853_1014700541 | 3300005539 | Corn Rhizosphere | VSVARLRLAPVRETMFPSRAPFFRCGLGPRAAEIAAWAEEKERGNLPVSP |
| Ga0066697_105364071 | 3300005540 | Soil | MSVARLRLAPARETMSPSRAPFFRDRLGPGAAEITACAEE |
| Ga0066661_106790632 | 3300005554 | Soil | MSVARLRLAPARETMFPSRAPFFRDRLGPGAAEITACAEE |
| Ga0066651_102771073 | 3300006031 | Soil | MTVARLRLAPVRETMFPSRAPFFRNRLSPRAAEIAAWAEENKRGNRTVS |
| Ga0070716_1002069131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGRLRLASVRETMFPSRAPFFRDRLNPRDAEIAAWAEENTRGNLPV |
| Ga0099791_104240771 | 3300007255 | Vadose Zone Soil | MNVARLWLAPVRETMFPSRAPFFRGRLGSRAAEIAACAEEKERGN |
| Ga0099793_100762151 | 3300007258 | Vadose Zone Soil | MIVARLRLAPVRETMFPSRALFFRDRLSPRAAEIAA |
| Ga0066710_1000472841 | 3300009012 | Grasslands Soil | MIFLARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAW |
| Ga0066710_1010978753 | 3300009012 | Grasslands Soil | MTAVARLRLARVRETMFPSRAPFFRDRLSSRAAEIAAWAEENKRGNLPVSP |
| Ga0066793_100062477 | 3300009029 | Prmafrost Soil | MSVARLRLAPTRATMFPSGAPFFLNARLGPRAAHVAALA |
| Ga0099827_1000214314 | 3300009090 | Vadose Zone Soil | VIVARLRLAPVRETMFPSRAPFFRFRLSPRAAEIAAWAEENKRGNLPVSP |
| Ga0099827_100548984 | 3300009090 | Vadose Zone Soil | MSVTHLRFVPVRETMFPSRAPFFRDRLSPRAAEIAAWAEE |
| Ga0099827_107498833 | 3300009090 | Vadose Zone Soil | MSVARLRLAPVGETMFPPRAPFFRVRLSPRGAPVAACAE |
| Ga0099827_112025621 | 3300009090 | Vadose Zone Soil | MSVARLRLAPVGETMFPPRAPFLRVRLSPRGAPVAACAEERKRGNLPVS |
| Ga0126308_107823941 | 3300010040 | Serpentine Soil | MSVARLRLAPVRETMFPLRDPFFVSRLSPRAAAIARCAEERVWGNLP |
| Ga0127472_11274211 | 3300010106 | Grasslands Soil | MSIARLTLALVGETMFPPRSAPFFGDRLSTRAAEIAACAEERE |
| Ga0126319_12533392 | 3300010147 | Soil | MSVARLRLAPVRETMFPSRAPFFKCRLSPRAAEIAAWAEEKEGGNLPVSSY |
| Ga0134063_105210243 | 3300010335 | Grasslands Soil | MSVARFQLAPVRETMFPSRAPFFRERFGLRAAAIAARA |
| Ga0134063_106175722 | 3300010335 | Grasslands Soil | MTVARLRLAPVRETMFPSRAPFFRGRLSPRAAEIAACAE |
| Ga0134062_104695091 | 3300010337 | Grasslands Soil | MIVARLRLAPVRETMFPSRALFFRSRLSARAAEIAACAEEREWGN |
| Ga0134127_124249641 | 3300010399 | Terrestrial Soil | MSVAYLRFAPVRETMFPSRAPFFRDRLSAHGVATAAVHAEEKEGGNLPI |
| Ga0151490_18101392 | 3300011107 | Soil | MMSVARLRLAPVRETMFPLRAPFFRCGLGPRAAEIAAWAE |
| Ga0120118_10051197 | 3300012010 | Permafrost | MSVVRLRLTLVRETMFPSRAPFFRDRLSARGVATAAAYTEEKERGGHPALPLPP |
| Ga0137382_109184311 | 3300012200 | Vadose Zone Soil | MTVARLRLAPVRESMFPSRAPFFRDRLSVRGVATPAANAEEQEWANLPVSA |
| Ga0137365_111491863 | 3300012201 | Vadose Zone Soil | MSVARLRLAPVRETMFRPRAPFLRNRLNPRAAEIAAWAEENKRGNRTVSP |
| Ga0137399_100872651 | 3300012203 | Vadose Zone Soil | MNVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAC |
| Ga0137380_113529141 | 3300012206 | Vadose Zone Soil | MSVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENK |
| Ga0137380_116239911 | 3300012206 | Vadose Zone Soil | MSVARLRLAPARETMFPSRAPFFKDRLSPRDIATAAARAEEKERGNLP |
| Ga0137376_103729243 | 3300012208 | Vadose Zone Soil | MTAVARLRLARVRETMFPSRAPFFRDRLSSRAAEIAAWAEENKRGNLPVS |
| Ga0137379_105740492 | 3300012209 | Vadose Zone Soil | MTVARLRLAPVGETVFPPRAPFFKVGPNPRGAQVAACAQDR |
| Ga0137379_106846203 | 3300012209 | Vadose Zone Soil | MSVVRFQLTPVRETMFPSRAPFFRYRLSPRAAEIAAWAEEKEGGN |
| Ga0137377_114733203 | 3300012211 | Vadose Zone Soil | LSVTRLRLVPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENER |
| Ga0137372_104155782 | 3300012350 | Vadose Zone Soil | MNVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEE |
| Ga0137386_109947782 | 3300012351 | Vadose Zone Soil | MIFLARLRLAPVRETMFPSRAPFFKDRLSPRDIATAAARAEEKERG |
| Ga0137367_103067972 | 3300012353 | Vadose Zone Soil | MNVARLRLAPVRETMFPSRAPFFRDRLGPRAAEIAAWAE |
| Ga0137371_111156791 | 3300012356 | Vadose Zone Soil | MSVARLRLALMRETMFPSRAPFFRDRLSPRAAEIAAWA |
| Ga0137371_111294682 | 3300012356 | Vadose Zone Soil | MTVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAA |
| Ga0137371_114176363 | 3300012356 | Vadose Zone Soil | MSLARLRLAPVRETMFPSRAPFFRDRLSTRAAEIAACAEDKQGGKL |
| Ga0137384_101020501 | 3300012357 | Vadose Zone Soil | MNVARLRLAPVRETMFPPRAPFFKCRLAARAAEIAATGEEKEA* |
| Ga0137385_105563571 | 3300012359 | Vadose Zone Soil | MNVARLRLAPVRETMFPSRAPFFRYRLSPRAAEIAA |
| Ga0137385_112831331 | 3300012359 | Vadose Zone Soil | MIFLARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENKG |
| Ga0134032_10693202 | 3300012376 | Grasslands Soil | MTVTHRRFVPVRETMFPSRAPFFGHRLSTRAAEIAACAEENKRGNLPVSP |
| Ga0134026_12392022 | 3300012381 | Grasslands Soil | MSIARLTLALVGETMFPPRSAPFFGDRLSTRAAEIAACAEERERGNLSVSP |
| Ga0137373_103419821 | 3300012532 | Vadose Zone Soil | MSVARLRLAPVGETMFPLRDPFLRSRPSSRAAEIAARAEEKGGGNPPISP |
| Ga0137394_115816092 | 3300012922 | Vadose Zone Soil | VSVARLRLAPVRETMFPSRAPFFGDRLSSRAAEIAACAEERERGNL |
| Ga0137394_116126891 | 3300012922 | Vadose Zone Soil | MTVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEEKKG |
| Ga0137416_101253493 | 3300012927 | Vadose Zone Soil | MSVARLRLVPVRETMFPSRAPFFRGRLSPRAAEIAAWAEENMRGNL |
| Ga0164298_106853711 | 3300012955 | Soil | MSVARLRLATAGETMSPPRAPFLRSRLSPRAAEIAAWAKENKRGNLP |
| Ga0164302_101175533 | 3300012961 | Soil | MNVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEET |
| Ga0120172_100033624 | 3300013765 | Permafrost | MTMVARLRLAPVRETMFASRAPFFRDRLSARGVATAAANAEDKVGGEK |
| Ga0134085_105495462 | 3300015359 | Grasslands Soil | MSIARLSLALAGETMFPPRSAPFFGDRLSTRAAEIAACAEERERGNLSVSP |
| Ga0163161_106571912 | 3300017792 | Switchgrass Rhizosphere | MSVGRLRLDPVRETMFPSRAPFFRDRLNPRAAEIAAWAEENTRG |
| Ga0184608_100039806 | 3300018028 | Groundwater Sediment | MSVARLRLALVRETMFPSRAPFFRDRISTPGVANTAARTEDSDGAC |
| Ga0184623_103160551 | 3300018056 | Groundwater Sediment | MTVARLRLAPVGETIFPPRAPFFRSRLSTRAAEIAA |
| Ga0184617_10074781 | 3300018066 | Groundwater Sediment | MSVARRRLAPVRETMFPSRAPFFRDRLSTRGVATAAARAE |
| Ga0184617_12237092 | 3300018066 | Groundwater Sediment | MNVARLRLAPVRETMFPSRAPFFRDRLNPRAAAIAAWAEEKEGG |
| Ga0193715_10799163 | 3300019878 | Soil | MSVARLRLAPVRETMFPSRAPIFGDRLSPRAAAIA |
| Ga0193733_10813921 | 3300020022 | Soil | VIVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWA |
| Ga0210378_103209411 | 3300021073 | Groundwater Sediment | MNVARLRLAPVRETMFPSRAPFFRDRLNPRAAAIAAWAEEKEGGNLPVSPY |
| Ga0193719_1000054014 | 3300021344 | Soil | MSVARLRLAPVRETMFPSRAPFLRDRLSPRAAELAAWAE |
| Ga0222622_109079511 | 3300022756 | Groundwater Sediment | MSVAPLQLAPVRETMFPSRAPFFRGGLGLRAAEIAAQTGEDERGNLTV |
| Ga0207642_101187843 | 3300025899 | Miscanthus Rhizosphere | MSVARLRLAPVRETMFSSRAPFFRDRLDPRAAEIAARVEETQWGNLPV |
| Ga0209468_11493693 | 3300026306 | Soil | MSVVRFQLTPVRETMFRSRAPFFRDRLSPRATEIAAWAE |
| Ga0209153_10586693 | 3300026312 | Soil | MSVARLRLAPVGETMFPLRDPFFRARLRARAAEIAA |
| Ga0209761_13105642 | 3300026313 | Grasslands Soil | MSLARLRLARVRKTMFPSRAPCFRYRLHPRAAEIAASAEEQE |
| Ga0209686_11695051 | 3300026315 | Soil | MSFVARLQLAPVGETMFPLRDPFFRDRLSPRAAAIAADAEET |
| Ga0209801_12421461 | 3300026326 | Soil | MSLARLRLARVRKTMFPSRAPFFRYRLHPRAAEIAAWAEEKERGKLTVSP |
| Ga0209887_10403161 | 3300027561 | Groundwater Sand | MSVARLRLAPVGETMFPLRNPFFRSRLSPGAAEIAACAE |
| Ga0307321_10735461 | 3300028704 | Soil | MSVTHLRFVPVRETMFPSRAPFFRDRLNARSVATAAASAEEKERGNLP |
| Ga0307295_101910401 | 3300028708 | Soil | MSVARLRLAPVRETMFPSRAPIFGDRLSPRAAEIAAW |
| Ga0307279_100227862 | 3300028709 | Soil | MSVARLQLAPVRETMFPSRAPFFRGRLSPRAAEIAAWAEEKERGNLTV |
| Ga0307313_100512931 | 3300028715 | Soil | MSVARLQLAPVRETMFPSRAPFFRGRLSPRAAEIAAWAEEKESG |
| Ga0307298_102554932 | 3300028717 | Soil | VIARLRLAPVRETMFPSRAPFFRDRVNPRAAEIAAWAEENKRGNLPVSP |
| Ga0307307_100304003 | 3300028718 | Soil | MSVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRT |
| Ga0307307_102521561 | 3300028718 | Soil | VIVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAWAKENKR |
| Ga0307315_102281171 | 3300028721 | Soil | MTVARLRLALVRETMFLSRAPFFKGGLSSRAAEIAACAEEKGWGNRTVSPA |
| Ga0307318_101354573 | 3300028744 | Soil | MSVARLRLAPVRETMFPSRAPFFRDRLSTRAAEIAACAEDRDVACD |
| Ga0307316_100291233 | 3300028755 | Soil | MSVARLRLAPVRETMFPSRAPIFGDRLSPRAAEIAAWVEEKKRGSLPVS |
| Ga0307316_101631471 | 3300028755 | Soil | MSVARLRLAPARETMFPPRAPFFKDRLSAHDMATAAAHAEEKE |
| Ga0307280_100570431 | 3300028768 | Soil | MSVARLRLARVRETMFPSRAPFFRDRLSSRAAEIAARAEEKER |
| Ga0307320_101517331 | 3300028771 | Soil | MNVARLRLAPVWETMFPSRAPFFRDRPSPRAAEIAAWAG |
| Ga0307282_102937622 | 3300028784 | Soil | VNVARLRLAPVRETMFPSRAPFFRDRLSPRAAEIAAC |
| Ga0307323_102902921 | 3300028787 | Soil | MSVARLRLTPVRETMFPSRAPFFRDRLSTRHVATAAASAEEKERGNLP |
| Ga0307323_103253972 | 3300028787 | Soil | MSVARLRLARVRETMFPSRAPFFRDRLSSRAAEIAARAEEKERGNLT |
| Ga0307290_100601122 | 3300028791 | Soil | MTVARLRLAPVGETMFPPRAPFFRDRLSARAAEIAAGAEEKEGGNLP |
| Ga0307284_101383651 | 3300028799 | Soil | MSVARLRLAPVRETMFPSRAPFFRDRLNPRAAEIAAWAEETE |
| Ga0307281_101859722 | 3300028803 | Soil | MSVAHLRLAPVRETMFPSRAPFFRDRLDPRAAEIAAWAEENKRGNLPVSPF |
| Ga0307305_101642541 | 3300028807 | Soil | MSVARLQLAPVRETMFPSRAPFFRGRLSPRAAEIAAWAEEKE |
| Ga0307305_103448931 | 3300028807 | Soil | VIARLRLAPVRETMFPSRAPFFRDRVNPRAAEIAAWAEENKRG |
| Ga0307292_102254481 | 3300028811 | Soil | MAVARMLAPVRETMFPSRAPFFWNRLSARAVATAAANAEEKEGGNFPVSPQ |
| Ga0307296_104861351 | 3300028819 | Soil | MSVARLRLAPVRETMFPSRAPFFRDRLNPRAAEIAAWAEETEGG |
| Ga0307312_100304041 | 3300028828 | Soil | MSVARLRLARVRETMFPSRAPFFRDGLSSRAAEIAAC |
| Ga0307278_103864792 | 3300028878 | Soil | MIFVARLRLAPVRETMFPSRAPFFRGRLNPRAAEIAAWVEEK |
| Ga0307277_100100891 | 3300028881 | Soil | MSVVRFQLTPVRETMFPSRAPFFRDRLSPRAAEIAAWAEEKE |
| Ga0307277_100273264 | 3300028881 | Soil | MSVARLRLAPVRETMFPSRAPFFRGRLNPRAAEIAAWA |
| Ga0307304_105938483 | 3300028885 | Soil | MSVARLRLAPVRETMFPSRAPFFSDRLGSRAAQIAAWA |
| Ga0307497_105604722 | 3300031226 | Soil | MSVARLRLAPVRETMFPSRAPFFRDRLDPRAAEIAAWAEETKRGN |
| ⦗Top⦘ |