


| Basic Information | |
|---|---|
| Family ID | F094208 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.85 % |
| % of genes near scaffold ends (potentially truncated) | 93.40 % |
| % of genes from short scaffolds (< 2000 bps) | 86.79 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.472 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.377 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.811 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.057 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.65% Coil/Unstructured: 82.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13563 | 2_5_RNA_ligase2 | 4.72 |
| PF00903 | Glyoxalase | 3.77 |
| PF07238 | PilZ | 2.83 |
| PF00464 | SHMT | 2.83 |
| PF16491 | Peptidase_M48_N | 2.83 |
| PF04255 | DUF433 | 1.89 |
| PF08281 | Sigma70_r4_2 | 1.89 |
| PF11645 | PDDEXK_5 | 1.89 |
| PF01566 | Nramp | 1.89 |
| PF00144 | Beta-lactamase | 1.89 |
| PF00753 | Lactamase_B | 1.89 |
| PF16694 | Cytochrome_P460 | 1.89 |
| PF12867 | DinB_2 | 1.89 |
| PF11999 | Ice_binding | 1.89 |
| PF01541 | GIY-YIG | 0.94 |
| PF01979 | Amidohydro_1 | 0.94 |
| PF11138 | DUF2911 | 0.94 |
| PF10647 | Gmad1 | 0.94 |
| PF01402 | RHH_1 | 0.94 |
| PF00145 | DNA_methylase | 0.94 |
| PF01828 | Peptidase_A4 | 0.94 |
| PF09844 | DUF2071 | 0.94 |
| PF02527 | GidB | 0.94 |
| PF13517 | FG-GAP_3 | 0.94 |
| PF09019 | EcoRII-C | 0.94 |
| PF05988 | DUF899 | 0.94 |
| PF00285 | Citrate_synt | 0.94 |
| PF03745 | DUF309 | 0.94 |
| PF01548 | DEDD_Tnp_IS110 | 0.94 |
| PF00202 | Aminotran_3 | 0.94 |
| PF13601 | HTH_34 | 0.94 |
| PF13231 | PMT_2 | 0.94 |
| PF03006 | HlyIII | 0.94 |
| PF04545 | Sigma70_r4 | 0.94 |
| PF04185 | Phosphoesterase | 0.94 |
| PF10518 | TAT_signal | 0.94 |
| PF02739 | 5_3_exonuc_N | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 2.83 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 2.83 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.89 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.89 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.89 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.89 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.94 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.94 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.94 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.94 |
| COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.94 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.47 % |
| Unclassified | root | N/A | 24.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10128919 | Not Available | 1143 | Open in IMG/M |
| 3300001991|JGI24743J22301_10020046 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300004080|Ga0062385_10219752 | Not Available | 1039 | Open in IMG/M |
| 3300005334|Ga0068869_100287306 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300005434|Ga0070709_10111822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1837 | Open in IMG/M |
| 3300005445|Ga0070708_100182071 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300005526|Ga0073909_10361270 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005542|Ga0070732_10249522 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005542|Ga0070732_10905464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005544|Ga0070686_100123017 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300005555|Ga0066692_10294622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300005591|Ga0070761_10335977 | Not Available | 913 | Open in IMG/M |
| 3300005591|Ga0070761_10577173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300005610|Ga0070763_10550394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300005712|Ga0070764_10397932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300005843|Ga0068860_100631022 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006086|Ga0075019_10511321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300006102|Ga0075015_100181331 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300006102|Ga0075015_100895126 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006175|Ga0070712_100528885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300006176|Ga0070765_100088608 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300006354|Ga0075021_11046688 | Not Available | 533 | Open in IMG/M |
| 3300006796|Ga0066665_10467391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Lujinxingiaceae → Lujinxingia → Lujinxingia litoralis | 1038 | Open in IMG/M |
| 3300006806|Ga0079220_11298786 | Not Available | 609 | Open in IMG/M |
| 3300009038|Ga0099829_10023249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4295 | Open in IMG/M |
| 3300009088|Ga0099830_10104000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
| 3300009094|Ga0111539_11439393 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009520|Ga0116214_1178476 | Not Available | 795 | Open in IMG/M |
| 3300009522|Ga0116218_1454070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010343|Ga0074044_10747408 | Not Available | 639 | Open in IMG/M |
| 3300010358|Ga0126370_11846225 | Not Available | 586 | Open in IMG/M |
| 3300010362|Ga0126377_10462814 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300010400|Ga0134122_10044478 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 3300010400|Ga0134122_10279843 | Not Available | 1423 | Open in IMG/M |
| 3300011271|Ga0137393_10678097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300012198|Ga0137364_10946688 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012199|Ga0137383_10754686 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012206|Ga0137380_11572965 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 542 | Open in IMG/M |
| 3300012207|Ga0137381_10744655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300012519|Ga0157352_1070493 | Not Available | 564 | Open in IMG/M |
| 3300012922|Ga0137394_10661657 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012925|Ga0137419_10523856 | Not Available | 944 | Open in IMG/M |
| 3300012927|Ga0137416_12222002 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300014154|Ga0134075_10586058 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 505 | Open in IMG/M |
| 3300014155|Ga0181524_10384259 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014168|Ga0181534_10091931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1513 | Open in IMG/M |
| 3300014200|Ga0181526_10260945 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 1104 | Open in IMG/M |
| 3300014495|Ga0182015_10055710 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300014968|Ga0157379_11940546 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015373|Ga0132257_104582931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300017933|Ga0187801_10518023 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017948|Ga0187847_10236866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300018001|Ga0187815_10125573 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300018007|Ga0187805_10335284 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300018012|Ga0187810_10436380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300018042|Ga0187871_10044271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2711 | Open in IMG/M |
| 3300018058|Ga0187766_10988007 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300018431|Ga0066655_11087574 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 558 | Open in IMG/M |
| 3300019890|Ga0193728_1100110 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300021170|Ga0210400_11393150 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300021178|Ga0210408_10545538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300021406|Ga0210386_10028301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4393 | Open in IMG/M |
| 3300021406|Ga0210386_11703273 | Not Available | 521 | Open in IMG/M |
| 3300021407|Ga0210383_11203231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300021418|Ga0193695_1121614 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021420|Ga0210394_11020322 | Not Available | 716 | Open in IMG/M |
| 3300021433|Ga0210391_10340798 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 1176 | Open in IMG/M |
| 3300021477|Ga0210398_10362076 | Not Available | 1182 | Open in IMG/M |
| 3300021478|Ga0210402_10793844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300025414|Ga0208935_1040026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300025906|Ga0207699_10515763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300025916|Ga0207663_10580531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300025928|Ga0207700_10912591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025942|Ga0207689_11502371 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026041|Ga0207639_10194880 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300026331|Ga0209267_1225228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300026538|Ga0209056_10373869 | Not Available | 910 | Open in IMG/M |
| 3300027432|Ga0209421_1138033 | Not Available | 503 | Open in IMG/M |
| 3300027604|Ga0208324_1044257 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300027641|Ga0208827_1110792 | Not Available | 803 | Open in IMG/M |
| 3300027701|Ga0209447_10221045 | Not Available | 516 | Open in IMG/M |
| 3300027842|Ga0209580_10149695 | Not Available | 1148 | Open in IMG/M |
| 3300027853|Ga0209274_10250059 | Not Available | 907 | Open in IMG/M |
| 3300027879|Ga0209169_10255165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300027882|Ga0209590_10862637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027884|Ga0209275_10027054 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300027889|Ga0209380_10372377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300027905|Ga0209415_10352030 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 1225 | Open in IMG/M |
| 3300028015|Ga0265353_1017888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300028745|Ga0302267_10005291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13628 | Open in IMG/M |
| 3300028906|Ga0308309_10152514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1861 | Open in IMG/M |
| 3300029943|Ga0311340_10919882 | Not Available | 726 | Open in IMG/M |
| 3300030007|Ga0311338_10175768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 2505 | Open in IMG/M |
| 3300030044|Ga0302281_10018577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4059 | Open in IMG/M |
| 3300030399|Ga0311353_11501079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300031231|Ga0170824_111916606 | Not Available | 1017 | Open in IMG/M |
| 3300031708|Ga0310686_111246300 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300031708|Ga0310686_111658287 | Not Available | 550 | Open in IMG/M |
| 3300031715|Ga0307476_10925435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300032160|Ga0311301_10121266 | All Organisms → cellular organisms → Bacteria | 4929 | Open in IMG/M |
| 3300032180|Ga0307471_102721786 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032783|Ga0335079_11940426 | Not Available | 569 | Open in IMG/M |
| 3300033806|Ga0314865_051362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300034163|Ga0370515_0081682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1403 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.94% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101289193 | 3300001356 | Peatlands Soil | PMPGHFKSGDSKWLPANYSHTITNTGTKAAKFVTLEFP* |
| JGI24743J22301_100200462 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | PMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR* |
| Ga0062385_102197521 | 3300004080 | Bog Forest Soil | SPRQASMATHLKSGDSKWLPANYSRTINTGAKPAKFVTLEFP* |
| Ga0068869_1002873061 | 3300005334 | Miscanthus Rhizosphere | DVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK* |
| Ga0070709_101118221 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RSDVEGQGPMPGKFMAGDAKWLPGGYSHTLTNTGKQTARFITFEFP* |
| Ga0070708_1001820714 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GMVPMPGRFKSGDVKWLPGGYTHTLTNVGRSPAKFVTVEFPAK* |
| Ga0073909_103612703 | 3300005526 | Surface Soil | FKSGDVKWLPGGYTHTLTNVGKSAAKFVTVEFPGK* |
| Ga0070732_102495221 | 3300005542 | Surface Soil | PMPGHLKSGDVKWLPGDYTHTLTNVGKQEAKFVTLEFH* |
| Ga0070732_109054641 | 3300005542 | Surface Soil | LQMRSDVVGQGPMPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTLEFH* |
| Ga0070686_1001230173 | 3300005544 | Switchgrass Rhizosphere | DLRSDVEGQGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR* |
| Ga0066692_102946221 | 3300005555 | Soil | SDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQAAKFVTLEFQ* |
| Ga0070761_103359772 | 3300005591 | Soil | IRSDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP* |
| Ga0070761_105771732 | 3300005591 | Soil | DVEGKGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH* |
| Ga0070763_105503941 | 3300005610 | Soil | DIVGQGPMPGIFKSGDVKWLAGGYTHTLTNVSNQPAKFVTLEFH* |
| Ga0070764_103979321 | 3300005712 | Soil | IRSDVQSQGSMPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP* |
| Ga0068860_1006310221 | 3300005843 | Switchgrass Rhizosphere | EGQGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR* |
| Ga0075019_105113212 | 3300006086 | Watersheds | LDLRSDVEGKGSMPGKFKSGDIKWVPGNYTHTLTNTGKQPARFVTLEF* |
| Ga0075015_1001813314 | 3300006102 | Watersheds | LDLRSDVEGKGPMPGKFKSGDVKWVPGGYTHTVTNVAKSPARFVTVEF* |
| Ga0075015_1008951261 | 3300006102 | Watersheds | PISVKIKAGDVRWVPGGYTHTLTNTGQQEAWFITLEF* |
| Ga0070712_1005288852 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QGPMPGHFKAGDIKWIPGGYTHTLTNTGKQSARFVAVEFP* |
| Ga0070765_1000886081 | 3300006176 | Soil | RSDVEGMGPMPGKFKSGDVKGLPGGNTHTLTNEGKSPARFVTVEL* |
| Ga0075021_110466881 | 3300006354 | Watersheds | MPGHIKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFQ* |
| Ga0066665_104673911 | 3300006796 | Soil | AGQGPVPGHFKSGDTKWLPGGYTHTLTNTGKQPARFITLEFPAEKTTK* |
| Ga0079220_112987862 | 3300006806 | Agricultural Soil | RSVGEGQSSTLTKLKSGDVKWLPGGYTHTLSNAAKQPAKFITLEFPQ* |
| Ga0099829_100232491 | 3300009038 | Vadose Zone Soil | GPNSGPMPAHFKSGDSKWLPGSYSHTITNTGAKPAKFVTLEFP* |
| Ga0099830_101040005 | 3300009088 | Vadose Zone Soil | EGMGPMPGHFKSGDVKWLPGGYSHTLTNVGKSNAKFITLEFP* |
| Ga0111539_114393931 | 3300009094 | Populus Rhizosphere | QGPMPGKFKSGDSKWLPGGYTHTLTNAGKQPAKFITLEFPR* |
| Ga0116214_11784762 | 3300009520 | Peatlands Soil | GHFKSGEVKWLPGGYTHTLTNVGKQQAKFVTLEFQ* |
| Ga0116218_14540702 | 3300009522 | Peatlands Soil | LDVRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQEAKFVTLEFH* |
| Ga0074044_107474081 | 3300010343 | Bog Forest Soil | PPSHFKSGDHKWLPASDSSAITNPSPKPAKFVTLEFP* |
| Ga0126370_118462252 | 3300010358 | Tropical Forest Soil | LDIRSDIEGAGPMPGKFKSGDVKWLRGGYTHTLTNTGSAVAKLVTVEFK* |
| Ga0126377_104628141 | 3300010362 | Tropical Forest Soil | DVAGKSPMPGHFKAGESKWIPGGYTHTLTNAGKQPAKFVTLEFH* |
| Ga0134122_100444781 | 3300010400 | Terrestrial Soil | QGPMPGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR* |
| Ga0134122_102798432 | 3300010400 | Terrestrial Soil | MPGKFKAGDVKWLPGGYTHTLTNTAKSTARLVTVEFKP* |
| Ga0137393_106780972 | 3300011271 | Vadose Zone Soil | GQLKSGEVKWLPGGYTHTLTNVGKQPAKFITLEFH* |
| Ga0137364_109466882 | 3300012198 | Vadose Zone Soil | GPMLGYFKSGDVKWLPGGYSHTLTNVGKAEAKFITLEFH* |
| Ga0137383_107546862 | 3300012199 | Vadose Zone Soil | EIRSDVVGQGPMPGHFKSGDVKWLPGGYSHTLTNVGKTEAKFITLEFH* |
| Ga0137380_115729651 | 3300012206 | Vadose Zone Soil | VGPMPGKFKSGDVKWLPGGYTHTLTNVGNSPAKFVTVEFPGK* |
| Ga0137381_107446553 | 3300012207 | Vadose Zone Soil | PAPAQLKSGDAKWLPGSYTHTLTNTGKQPAKFVTVEFP* |
| Ga0157352_10704931 | 3300012519 | Unplanted Soil | KGPMPVKLKSGDSKWLAGGYTHTLTNTGKQPAKFITLEFPK* |
| Ga0137394_106616571 | 3300012922 | Vadose Zone Soil | MPGHFKSGDSKWLPGNYSHTITNVGKHPAKFMTLQFP* |
| Ga0137419_105238561 | 3300012925 | Vadose Zone Soil | PMPGHFKSGESKWLPGGYSHTITNVGRLPAKFVTVEFP* |
| Ga0137416_122220022 | 3300012927 | Vadose Zone Soil | RSDVEGMGPMPGKFKSSDVKWLPGGYTHTLTNVGKSAVKFVTVEFPGN* |
| Ga0134075_105860581 | 3300014154 | Grasslands Soil | GPMPGKFKSGDVKWLPGGYTHTLTNVGNSPAKFVTVEFPGK* |
| Ga0181524_103842592 | 3300014155 | Bog | DVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH* |
| Ga0181534_100919313 | 3300014168 | Bog | FMSGQVKWLPGGYSHTLTNTGKTPAKFVTLEFPAGTPK* |
| Ga0181526_102609453 | 3300014200 | Bog | DVEGQGSMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH* |
| Ga0182015_100557103 | 3300014495 | Palsa | MDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP* |
| Ga0157379_119405461 | 3300014968 | Switchgrass Rhizosphere | RSDVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK* |
| Ga0132257_1045829312 | 3300015373 | Arabidopsis Rhizosphere | EGKGPMPGHFKAGESKWIPGGYTHTLTNVGKEPAKFVTLEFH* |
| Ga0187801_105180232 | 3300017933 | Freshwater Sediment | EGMGPMPGKLKAGDVKWLPGGYTHTLTNTGARPARFVTVEF |
| Ga0187847_102368661 | 3300017948 | Peatland | MPGKFKSGDIKWLPGGYTHTLTNVGQSPARFVTVEF |
| Ga0187815_101255732 | 3300018001 | Freshwater Sediment | EIRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Ga0187805_103352842 | 3300018007 | Freshwater Sediment | DVELRSDVEGKGPMPGKFKSGDVKWLPGDYTHTLTNTSKQTARFVIVEF |
| Ga0187810_104363801 | 3300018012 | Freshwater Sediment | GQGPMPGKFKSGDVKWLPGGYTHTVTNVGKSLARLVTVEF |
| Ga0187871_100442711 | 3300018042 | Peatland | FMSGQVKWLPGGYSHTLTNTGKTPAKFVTLEFPAGTPK |
| Ga0187766_109880071 | 3300018058 | Tropical Peatland | PMPAKLKAGDVKWVPGGFTHTLTNTGTLGARLVTVEFAEAKE |
| Ga0066655_110875742 | 3300018431 | Grasslands Soil | GQGPMPGRFKSGDVKWLPGGYTHTLTNTGKAPARLVTVEFK |
| Ga0193728_11001102 | 3300019890 | Soil | DVVGQGPMLGYFKSGDVKWLPGGYSHTLTNVGKAEAKFITLEFH |
| Ga0210400_113931502 | 3300021170 | Soil | RSQPGHFKSGDSKWFPGGYWRAVTNVGHNPAKYVILEFP |
| Ga0210408_105455382 | 3300021178 | Soil | MPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTMEFH |
| Ga0210386_100283011 | 3300021406 | Soil | EGQGPMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKLVTLEFQ |
| Ga0210386_117032731 | 3300021406 | Soil | VNFKSGDAKWLPGGYIHTLTNISNQEAKFVTLEFH |
| Ga0210383_112032312 | 3300021407 | Soil | LEIRSDVEGKGPMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKLVTLEFQ |
| Ga0193695_11216142 | 3300021418 | Soil | DLEIRSDVVGQGPMLGYFKSGDVKWLPGGYSHTLTNLGKAEAKFITLEFH |
| Ga0210394_110203223 | 3300021420 | Soil | VEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP |
| Ga0210391_103407983 | 3300021433 | Soil | PMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Ga0210398_103620762 | 3300021477 | Soil | IRSDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTATKPAKFVTLEFP |
| Ga0210402_107938441 | 3300021478 | Soil | PTLGHLKSGEVKWLPGGYTHTLTNVGKQDAKFVTLEFH |
| Ga0208935_10400261 | 3300025414 | Peatland | IRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Ga0207699_105157631 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSDVEGQGPMPGKFMAGDAKWLPGGYSHTLTNTGKQTARFITFEFP |
| Ga0207663_105805312 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVKWLPGDYTHTLTNTGKSVAKFVILEFPPSANAK |
| Ga0207700_109125911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GSGPMPGKFKAGDIKWLPGGYTHTLTNVGKDSARFITLEF |
| Ga0207689_115023711 | 3300025942 | Miscanthus Rhizosphere | DVEGQGQMQAKIKSGDSKWVAGGFTHTVTNIGKQPAKFIALEFPK |
| Ga0207639_101948801 | 3300026041 | Corn Rhizosphere | PGKFKSGDSKWLPGGYTHTLTNTGKQPAKFITLEFPR |
| Ga0209267_12252281 | 3300026331 | Soil | DLEVRSDVEGQGPMPGHFKSGDVKWLPGGYTHTLTNVGKQAAKFVTLEFQ |
| Ga0209056_103738691 | 3300026538 | Soil | GHFKSGDTKWLPGGYTHTLTNTGKQPARFITLEFPAEKTTK |
| Ga0209421_11380331 | 3300027432 | Forest Soil | VSDVYLRSDTPRQASVATHLKSGDSKWLPANYSRTINTGTKAAKFVTLEFP |
| Ga0208324_10442573 | 3300027604 | Peatlands Soil | VPMSAHFKPGDVQWLPAGLTHTLTNTAHTPAKFVTLEFH |
| Ga0208827_11107921 | 3300027641 | Peatlands Soil | GHFKSGDFKWLPGGYTHTLTNVGKQEAKFVTLEFH |
| Ga0209447_102210451 | 3300027701 | Bog Forest Soil | SGEVEWIPGGVTHSLTNIGKQQAKFVTLEFHDPKELL |
| Ga0209580_101496951 | 3300027842 | Surface Soil | GKGPMPGHLKSGDVKWLPGDYTHTLTNVGKQEAKFVTLEFH |
| Ga0209274_102500591 | 3300027853 | Soil | SDVEGMGPMPGHFKSGDSKWLPGNYSHTITNTGTKPAKFVTLEFP |
| Ga0209169_102551652 | 3300027879 | Soil | MPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP |
| Ga0209590_108626372 | 3300027882 | Vadose Zone Soil | MPGHFKSADVKWLPGGYSHTVTNVGKSEAKFITLEFH |
| Ga0209275_100270544 | 3300027884 | Soil | QGPMPGHFKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Ga0209380_103723771 | 3300027889 | Soil | GSAPTAEKLKAGEVKWLPGGYTHTVTNVGKTPARIVAVEF |
| Ga0209415_103520303 | 3300027905 | Peatlands Soil | PMPGHLKSGDVKWLPGGYTHTLTNTGKQEAKFVTLEFH |
| Ga0265353_10178882 | 3300028015 | Soil | SDVQSQGSMPEHFKSGDSKWLPGNYSSTITNTGSKPAKFVTLEFP |
| Ga0302267_1000529118 | 3300028745 | Bog | APTLAKFKSGEIKWLPGGYTHTVTNVGKSPARLVTVEF |
| Ga0308309_101525143 | 3300028906 | Soil | SHPASHMKSGDSKWLPGNITHTVTNTGTKPAKFVTLEFP |
| Ga0311340_109198821 | 3300029943 | Palsa | MDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP |
| Ga0311338_101757681 | 3300030007 | Palsa | VHGMDPRPGHFKSGDSKWLPGNYAHTLTNTGTNPAKFVTLEFP |
| Ga0302281_100185771 | 3300030044 | Fen | RAPTLAKFKSGEIKWLPGGYTHTVTNVGKSPARLVTVEF |
| Ga0311353_115010791 | 3300030399 | Palsa | DIRSDVEGQIPMLGHFKSGDSKWLPGGYSHSITNAGAAPAKFVTLEFP |
| Ga0170824_1119166061 | 3300031231 | Forest Soil | DVEGQGPNSGPMPAHFKSGDSKWLPGNYSHTLTNTGAKPARFVTLEFP |
| Ga0310686_1112463001 | 3300031708 | Soil | PMPGIFKSGDVKWLPGGYTHTLTNVSNQPAKFVTLEFH |
| Ga0310686_1116582871 | 3300031708 | Soil | DLGHFMSGQVQWLPGDYSQTITNTGKTKAKFVTLEFPPQSK |
| Ga0307476_109254353 | 3300031715 | Hardwood Forest Soil | GQGPMPGKFKAGDIKWLPGGYTHTLTNVGKNPARMVTVEF |
| Ga0318501_102419703 | 3300031736 | Soil | RSDVQGRGPSTVQLKAGDIKWVPGGYTHTLTNTGKQAAKFVAVEFP |
| Ga0311301_101212662 | 3300032160 | Peatlands Soil | MPAHLKSGEYKWLPGNYSHTITNIGSKPAKFVTLEFP |
| Ga0307471_1027217862 | 3300032180 | Hardwood Forest Soil | SDVVGQGPMLGYFKSGDVKWSPGGYSHTLTNVGKAEAKFITLEFH |
| Ga0335079_119404261 | 3300032783 | Soil | VEGRGPMPEHLKAGEVKWLPGGYTHTVTNMSKQPAKIVTLEFQP |
| Ga0310914_103444841 | 3300033289 | Soil | SDVQGRGPSTVQLKAGDIKWVPGGYTHTLTNTGKQAAKFVAVEFP |
| Ga0314865_051362_478_603 | 3300033806 | Peatland | MPAKLKAGDVKWVPGGFTHTLTNTGTSVARLVTVEFAGAKE |
| Ga0370515_0081682_1216_1347 | 3300034163 | Untreated Peat Soil | MERKSPKPGHFKSGDSKWLPANYSHTLANTGTKPAKFVTLEFP |
| ⦗Top⦘ |