


| Basic Information | |
|---|---|
| Family ID | F094130 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGA |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.23 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.623 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.151 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.811 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.679 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 10.81% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 10.38 |
| PF00355 | Rieske | 6.60 |
| PF09339 | HTH_IclR | 4.72 |
| PF01614 | IclR | 3.77 |
| PF14759 | Reductase_C | 2.83 |
| PF03446 | NAD_binding_2 | 1.89 |
| PF02410 | RsfS | 0.94 |
| PF00171 | Aldedh | 0.94 |
| PF02590 | SPOUT_MTase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 3.77 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.94 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.94 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.62 % |
| Unclassified | root | N/A | 10.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_745399_length_1779_cov_8.101743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1811 | Open in IMG/M |
| 2170459015|G14TP7Y02JECBK | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300000550|F24TB_12281769 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10172034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300000891|JGI10214J12806_10516195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300001545|JGI12630J15595_10105557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300002914|JGI25617J43924_10115058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300004157|Ga0062590_101439596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300004267|Ga0066396_10058444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300005174|Ga0066680_10090773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1856 | Open in IMG/M |
| 3300005330|Ga0070690_101040953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300005340|Ga0070689_100331236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
| 3300005437|Ga0070710_10955375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300005440|Ga0070705_101866675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300005467|Ga0070706_102058879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300005468|Ga0070707_101044934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300005471|Ga0070698_101781356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300005471|Ga0070698_101786861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300005518|Ga0070699_101328156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300005575|Ga0066702_10762863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 576 | Open in IMG/M |
| 3300005764|Ga0066903_103846286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 806 | Open in IMG/M |
| 3300005764|Ga0066903_103922802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 798 | Open in IMG/M |
| 3300005764|Ga0066903_104693437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
| 3300005764|Ga0066903_107532428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300006038|Ga0075365_10110287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1890 | Open in IMG/M |
| 3300006057|Ga0075026_100236983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 974 | Open in IMG/M |
| 3300006177|Ga0075362_10147269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300006178|Ga0075367_10085118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1918 | Open in IMG/M |
| 3300006186|Ga0075369_10131390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
| 3300006844|Ga0075428_101136052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300009089|Ga0099828_10275443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1511 | Open in IMG/M |
| 3300009100|Ga0075418_10460923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1362 | Open in IMG/M |
| 3300009143|Ga0099792_10864605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300009148|Ga0105243_11402417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300009162|Ga0075423_12318787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300009176|Ga0105242_10948601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300009792|Ga0126374_10513439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300010046|Ga0126384_10773480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300010048|Ga0126373_12732903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300010361|Ga0126378_11519271 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300010362|Ga0126377_13616345 | Not Available | 500 | Open in IMG/M |
| 3300010366|Ga0126379_10564231 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300010373|Ga0134128_10606521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1218 | Open in IMG/M |
| 3300010396|Ga0134126_11610179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300010399|Ga0134127_11254307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300012189|Ga0137388_11377730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 644 | Open in IMG/M |
| 3300012353|Ga0137367_11177226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300012683|Ga0137398_10306103 | Not Available | 1069 | Open in IMG/M |
| 3300012923|Ga0137359_10203368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1769 | Open in IMG/M |
| 3300012927|Ga0137416_11528784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300012971|Ga0126369_10968945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 938 | Open in IMG/M |
| 3300013102|Ga0157371_11452720 | Not Available | 534 | Open in IMG/M |
| 3300015077|Ga0173483_10699321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300015374|Ga0132255_103542402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300018067|Ga0184611_1011721 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300018072|Ga0184635_10287949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300018082|Ga0184639_10046752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2231 | Open in IMG/M |
| 3300018433|Ga0066667_11637170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300018466|Ga0190268_11797694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300018469|Ga0190270_13297449 | Not Available | 512 | Open in IMG/M |
| 3300020004|Ga0193755_1140137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300020008|Ga0193757_1017042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300020199|Ga0179592_10222111 | Not Available | 853 | Open in IMG/M |
| 3300025910|Ga0207684_10004891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12509 | Open in IMG/M |
| 3300025928|Ga0207700_11030852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300025945|Ga0207679_10317052 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300026312|Ga0209153_1259687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300026327|Ga0209266_1234492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300026532|Ga0209160_1090030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1587 | Open in IMG/M |
| 3300026538|Ga0209056_10021057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6361 | Open in IMG/M |
| 3300027050|Ga0209325_1021192 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300027288|Ga0208525_1001327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2421 | Open in IMG/M |
| 3300027583|Ga0209527_1036376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1105 | Open in IMG/M |
| 3300027866|Ga0209813_10071411 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300027907|Ga0207428_10311394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300027909|Ga0209382_10092183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3559 | Open in IMG/M |
| 3300028047|Ga0209526_10003082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11310 | Open in IMG/M |
| 3300028536|Ga0137415_10365274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1247 | Open in IMG/M |
| 3300028587|Ga0247828_11076182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300028587|Ga0247828_11162783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300028718|Ga0307307_10239530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300028720|Ga0307317_10092104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1000 | Open in IMG/M |
| 3300028721|Ga0307315_10101010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300028744|Ga0307318_10014447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2528 | Open in IMG/M |
| 3300031184|Ga0307499_10205963 | Not Available | 607 | Open in IMG/M |
| 3300031549|Ga0318571_10179230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031549|Ga0318571_10363796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300031668|Ga0318542_10023212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2584 | Open in IMG/M |
| 3300031668|Ga0318542_10456314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300031679|Ga0318561_10039999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2308 | Open in IMG/M |
| 3300031740|Ga0307468_102313517 | Not Available | 522 | Open in IMG/M |
| 3300031763|Ga0318537_10083267 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031764|Ga0318535_10186368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 928 | Open in IMG/M |
| 3300031764|Ga0318535_10477643 | Not Available | 554 | Open in IMG/M |
| 3300031765|Ga0318554_10067158 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300031793|Ga0318548_10418747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300031794|Ga0318503_10032599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1534 | Open in IMG/M |
| 3300031797|Ga0318550_10001190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7843 | Open in IMG/M |
| 3300031832|Ga0318499_10101786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1111 | Open in IMG/M |
| 3300031859|Ga0318527_10518920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300031938|Ga0308175_102370701 | Not Available | 595 | Open in IMG/M |
| 3300031944|Ga0310884_10127745 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300032003|Ga0310897_10288074 | Not Available | 747 | Open in IMG/M |
| 3300032012|Ga0310902_10454665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300033004|Ga0335084_12391571 | Not Available | 509 | Open in IMG/M |
| 3300033290|Ga0318519_10357058 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_03135230 | 2140918013 | Soil | MQILCTNGVKSVLLELIPSFERARDTKLAVTWGSTHALLKELESGVGGDVAILTAEAID |
| 4PV_00144090 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLKELEAGAGG |
| F24TB_122817691 | 3300000550 | Soil | MDILCTNGVKSVMLDLIPAFERARRTNVAITWGSTNALLKGLESAAVGDVAVLTAEAID |
| AF_2010_repII_A1DRAFT_101720341 | 3300000597 | Forest Soil | MEILCTNGVKSVMLDLVPAFERVSGTKIVITWGSTAALLKDLEGGAG |
| JGI10214J12806_105161952 | 3300000891 | Soil | MKVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELETGAGGDLAIL |
| JGI12630J15595_101055572 | 3300001545 | Forest Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGA |
| JGI25617J43924_101150582 | 3300002914 | Grasslands Soil | MDILCTNGVKSVMLELVPVFERARSTKIAVTWGSTNALLKDIKGGVGGDVAVLTAEAVDELI |
| Ga0062590_1014395961 | 3300004157 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKAVITWGSANGLLKELETGAGGDLAILTAEA |
| Ga0066396_100584441 | 3300004267 | Tropical Forest Soil | MDILCTNGVKSVMLELVPAFERAHSTKIAVTWGSTNALLNEIKGGAGGDVAVLTAE |
| Ga0066680_100907733 | 3300005174 | Soil | MEVLCTNGLKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAILT |
| Ga0070690_1010409532 | 3300005330 | Switchgrass Rhizosphere | MRVLCTNGLKTVMLDLAPDFEHTIGTKAVITWGSANGLLKELETGAGGDLAILTAEAIDGLIK |
| Ga0070689_1003312361 | 3300005340 | Switchgrass Rhizosphere | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLKELEAGAGGDLAI |
| Ga0070710_109553751 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELETG |
| Ga0070705_1018666752 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAILTAEAI |
| Ga0070706_1020588791 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDL |
| Ga0070707_1010449342 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLCTNGLKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLE |
| Ga0070698_1017813562 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLCTNGLKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGG |
| Ga0070698_1017868612 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEILCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGG |
| Ga0070699_1013281562 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MEILCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGG |
| Ga0066702_107628631 | 3300005575 | Soil | MDILCTNGVKSVMLELLPEFERARSTKIAVTWGSTNALLKDIKAGL |
| Ga0066903_1038462861 | 3300005764 | Tropical Forest Soil | MEILCTNGVKSVMLDLLPAFERARSTKLAVTWGSTNALLKDLGSGAGGDVAILTAEAIDELVN |
| Ga0066903_1039228022 | 3300005764 | Tropical Forest Soil | MKVICTNGVKSIMLDLVPAFERTSGTKIVITWGSTNGLLKELEGGAVGDLA |
| Ga0066903_1046934372 | 3300005764 | Tropical Forest Soil | MEMLCTNGVKSLMLDLVPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAILTAEAI |
| Ga0066903_1075324281 | 3300005764 | Tropical Forest Soil | MEMLCTNGVKSLMLDVVPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAILTA |
| Ga0075365_101102873 | 3300006038 | Populus Endosphere | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLKELEAGAGGDL |
| Ga0075026_1002369832 | 3300006057 | Watersheds | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELETGAGGDLAILTAEAIDG |
| Ga0075362_101472693 | 3300006177 | Populus Endosphere | MKVLCTNGMKSVMLELVPEFERSTGIKSVITWGSAN |
| Ga0075367_100851181 | 3300006178 | Populus Endosphere | MRVLCTNGLKTVMLELAPDFERTIGTKAVITWGSANGLLKE |
| Ga0075369_101313901 | 3300006186 | Populus Endosphere | MRVLCTNGLKTVMLDLAPDFERTIGTKAVITWGSANGLL |
| Ga0075428_1011360521 | 3300006844 | Populus Rhizosphere | MKVLCTNGMKSVMLELVPEFERSTGIKSVITWGSANGLLKELEAGA |
| Ga0099828_102754431 | 3300009089 | Vadose Zone Soil | MIGKRERIAAMEVLCTNGVKSVMLDLIPAFERTSGTKIVVTWGSTNGLLKDLE |
| Ga0075418_104609232 | 3300009100 | Populus Rhizosphere | MQILCTNGVKSVLLELIPSFERARDTKLAVSWGSTHALL |
| Ga0099792_108646052 | 3300009143 | Vadose Zone Soil | MDILCTNGVKSVMLELVPVFERARSTKIAVTWGSTNALLKDI |
| Ga0105243_114024171 | 3300009148 | Miscanthus Rhizosphere | MRVLCTNGLKTVMLDLAPDFERAIGTKVTVTWGSANGLLKELETGVG |
| Ga0075423_123187872 | 3300009162 | Populus Rhizosphere | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLKELEAGAGGDLAILTA |
| Ga0105242_109486012 | 3300009176 | Miscanthus Rhizosphere | MQILCTNGVKSVLLELIPSFERARDTKLAVTWGSTHALLKDLESG |
| Ga0126374_105134391 | 3300009792 | Tropical Forest Soil | MKVLCTNGLKSVMLELVPEFERSTGIKSVITWGSANGLLKELEAGAGA |
| Ga0126384_107734802 | 3300010046 | Tropical Forest Soil | MQILCTNGVKSVLLELISAFERARDTKLAVTWGSTQTLLK |
| Ga0126373_127329032 | 3300010048 | Tropical Forest Soil | MKVICTNGVKSVMLDLVPAFGRTSGTKISITWGSTNGLLKEV |
| Ga0126378_115192711 | 3300010361 | Tropical Forest Soil | MKIICTNGVKSVMLDLVPAFERTSGTKISITWGSTN |
| Ga0126377_136163452 | 3300010362 | Tropical Forest Soil | MKVLCTNGVKSVMLDLAPAFERTSGTKVLITWGATNGLVKELDGGAA |
| Ga0126379_105642311 | 3300010366 | Tropical Forest Soil | MIGKRERIAAMEILCTNGVKSVMVDLVPTFERTSGTKVMITWGATNSLLKDLEGGAGGDL |
| Ga0134128_106065212 | 3300010373 | Terrestrial Soil | MQILCTNGVKSVLLELIPSFERARNTKLAVNWGSTHALLKDLESGVGGD |
| Ga0134126_116101792 | 3300010396 | Terrestrial Soil | MRVLCTNGLKTVMLDLAPDFERTIGSKVVITWGSANGLLKELETGAGGDLAILTAEAIDGLI |
| Ga0134127_112543072 | 3300010399 | Terrestrial Soil | MQILCTNGVKSVLLELIPSFERARDTKLAVTWGSTHALLKELE |
| Ga0137388_113777303 | 3300012189 | Vadose Zone Soil | MKVLCTNGVKTLMLDLVLAFERSSGTKLAVTWGSAAGLV |
| Ga0137367_111772262 | 3300012353 | Vadose Zone Soil | MKMICTNGVKSVMLDLVPAFERTSGTKISITWGSTNGLLRELEGGAGGDLA |
| Ga0137398_103061033 | 3300012683 | Vadose Zone Soil | MRVLCTNGLKTVMLDLTPAFERSSGTKLAITWGSA |
| Ga0137359_102033681 | 3300012923 | Vadose Zone Soil | MIGKRERIAAMEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGL |
| Ga0137416_115287841 | 3300012927 | Vadose Zone Soil | MIGKRERIAAMEVLCTNGVKSVMLDLIPAFERTSGTKIVVTWGSTNGLLKDL |
| Ga0126369_109689451 | 3300012971 | Tropical Forest Soil | MKVLCTNGVKSVMLDLAPAFERTSGTKVLITWGATNGLVKELDGGAAADL |
| Ga0157371_114527201 | 3300013102 | Corn Rhizosphere | MKVLCTNGLKTVMLDLAPDFERTIGTKVTVTWGSANSLLKEL |
| Ga0173483_106993211 | 3300015077 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKAVITWGSANGLLKELETGAGGDLAILTAEAI |
| Ga0132255_1035424022 | 3300015374 | Arabidopsis Rhizosphere | MRVLCTNGLKTVMLDLAPDFEHTIGTKAVITWGSANGLLKELETGAG |
| Ga0184611_10117211 | 3300018067 | Groundwater Sediment | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKEL |
| Ga0184635_102879492 | 3300018072 | Groundwater Sediment | MKVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELE |
| Ga0184639_100467523 | 3300018082 | Groundwater Sediment | MKVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELETGASGDLAILT |
| Ga0066667_116371702 | 3300018433 | Grasslands Soil | MEVLCTNGLKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGD |
| Ga0190268_117976942 | 3300018466 | Soil | MRVLCTNGLKTVMLDLSPDFERAIGTKAVITWGSANGLLK |
| Ga0190270_132974492 | 3300018469 | Soil | MKVLCTNGLKTVMLDLAPDFERAIGTKVTVTWGSA |
| Ga0193755_11401372 | 3300020004 | Soil | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKE |
| Ga0193757_10170421 | 3300020008 | Soil | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELETGAGGDLA |
| Ga0179592_102221113 | 3300020199 | Vadose Zone Soil | MDILCTNGVKSVMLELVPVFERARSTKIAVTWGSTNALLK |
| Ga0207684_100048911 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLE |
| Ga0207700_110308521 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQILCTNGVKSVLLELIPSFERARDTKLAVTWGSTHALLKDLESGVGGDVAILTAEAIDD |
| Ga0207679_103170523 | 3300025945 | Corn Rhizosphere | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSA |
| Ga0209153_12596871 | 3300026312 | Soil | MIAARHVLCTNGVKSVLLELIPAFERARDAKLAVTWGSTQALLKDLETGAGGDVAILTAEAIDD |
| Ga0209266_12344921 | 3300026327 | Soil | MEILCTNGVKSVMLDLIPAFERAGNTKVATTWGSTNALL |
| Ga0209160_10900301 | 3300026532 | Soil | MEVLCTNGLKSVMLYLIPAFERTSGTKIVITWGSTNGLLKDLEGGAG |
| Ga0209056_100210578 | 3300026538 | Soil | MEVLCTNGLKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAIL |
| Ga0209325_10211922 | 3300027050 | Forest Soil | MEILCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAG |
| Ga0208525_10013273 | 3300027288 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELETGAGGDLAILTAEA |
| Ga0209527_10363761 | 3300027583 | Forest Soil | MEILCTNGVKSVMLDLIPTFERTSGTKIVITWGSTNGLVKDLEGGAGG |
| Ga0209813_100714111 | 3300027866 | Populus Endosphere | MRVLCTNGLKTVMLELAPDFERTIGTKAVITWGSANGLLK |
| Ga0207428_103113942 | 3300027907 | Populus Rhizosphere | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLK |
| Ga0209382_100921834 | 3300027909 | Populus Rhizosphere | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLQELEAGA |
| Ga0209526_100030821 | 3300028047 | Forest Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAVLTAEAID |
| Ga0137415_103652743 | 3300028536 | Vadose Zone Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGG |
| Ga0247828_110761822 | 3300028587 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELETGAGGDLAIL |
| Ga0247828_111627832 | 3300028587 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELE |
| Ga0307307_102395301 | 3300028718 | Soil | MQILCTNGVKSVLLELIPSFERARDTKLAVTWGSTLALLKDLESGGGGDVAIL |
| Ga0307317_100921041 | 3300028720 | Soil | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELETGAGGD |
| Ga0307315_101010101 | 3300028721 | Soil | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLK |
| Ga0307318_100144471 | 3300028744 | Soil | MRVLCTNGLKTVMLDLSPDFERTIGTKVVITWGSANGLLKELETGAGG |
| Ga0307499_102059631 | 3300031184 | Soil | MKVLCTNGLKTVMLDLAPDFERAIGTKVTVTWGSANG |
| Ga0318571_101792302 | 3300031549 | Soil | MEILCTNGVKSVMLDLLPAFERARSTKLAVTWGSTNALVKDLGSG |
| Ga0318571_103637961 | 3300031549 | Soil | MEILCTNGVKSVMLDLVPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAILSAEAI |
| Ga0318542_100232124 | 3300031668 | Soil | MKVICTNGVKSIMLDLVPAFERTSGTKIVITWGSTNGLLKE |
| Ga0318542_104563142 | 3300031668 | Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTN |
| Ga0318561_100399991 | 3300031679 | Soil | MEILCTNGVKSVMLDLLPAFERARSTKLAVTWGSTNA |
| Ga0307468_1023135172 | 3300031740 | Hardwood Forest Soil | MKILCTNGLKTVMLDLMPAFERASGTKVVTVWGSANGLLKELESGAS |
| Ga0318537_100832673 | 3300031763 | Soil | MEILCTNGVKSVMLDLLPAFERARSTKLAVTWGSTNALVKDLGSGAGGDVAILTAEAIDE |
| Ga0318535_101863683 | 3300031764 | Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLK |
| Ga0318535_104776432 | 3300031764 | Soil | MKIVCTNGVKSVMLDLVSQFERRSATKLTVVWGATNTLIKELEGGADGD |
| Ga0318554_100671581 | 3300031765 | Soil | MKVICTNGVKSVMLDLAPAFERTSGTKISITWGSTNGLLKELEGGAGGDLAILTAEA |
| Ga0318548_104187471 | 3300031793 | Soil | MEVLCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGADGDLAVLTAEAI |
| Ga0318503_100325993 | 3300031794 | Soil | MEILCTNGVKSVMLDLVPAFERTSGTKIVITWGSTNGLLT |
| Ga0318550_100011901 | 3300031797 | Soil | MKIVCTNGVKSVMLDLVSQFERRSATKLTVVWGATNTL |
| Ga0318499_101017863 | 3300031832 | Soil | MEVLCTNGVKSVMLDLIPAFERASGTKIVITWGSTNGLLK |
| Ga0318527_105189202 | 3300031859 | Soil | MEILCTNGVKSVMLDLIPAFERTSGTKIVITWGSTNGLLKDLEGGAGGDLAVLT |
| Ga0308175_1023707011 | 3300031938 | Soil | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLQELEAGAGGD |
| Ga0310884_101277451 | 3300031944 | Soil | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSANGLLKELEAG |
| Ga0310897_102880741 | 3300032003 | Soil | MRVLCTNGLKTVMLDLAPEFERAIGTKAVITWGSAN |
| Ga0310902_104546652 | 3300032012 | Soil | MRVLCTNGLKTVMLDLAPDFERTIGTKVVITWGSANGLLKELETGAGGDLAILTAEAID |
| Ga0335084_123915712 | 3300033004 | Soil | MKVLCTNGLKTVMLELASHFEGAIGTKPVMTWGSAAGLVKELDG |
| Ga0318519_103570582 | 3300033290 | Soil | MEILCTNGVKSVMLDLVPAFERTSGTKIVITWGSTNALLKDLEGGADGDLAVLTAEAIDD |
| ⦗Top⦘ |