


| Basic Information | |
|---|---|
| Family ID | F094087 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MAVLWTFREPSLCRHVRRELMRNALLDLTPIIPATACHQRNYVETYSR |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.06 % |
| % of genes from short scaffolds (< 2000 bps) | 99.06 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.151 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.58% β-sheet: 0.00% Coil/Unstructured: 43.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13358 | DDE_3 | 2.83 |
| PF04307 | YdjM | 1.89 |
| PF01243 | Putative_PNPOx | 1.89 |
| PF04754 | Transposase_31 | 1.89 |
| PF13518 | HTH_28 | 1.89 |
| PF00496 | SBP_bac_5 | 0.94 |
| PF03795 | YCII | 0.94 |
| PF13610 | DDE_Tnp_IS240 | 0.94 |
| PF03050 | DDE_Tnp_IS66 | 0.94 |
| PF13565 | HTH_32 | 0.94 |
| PF00589 | Phage_integrase | 0.94 |
| PF00067 | p450 | 0.94 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.94 |
| PF13613 | HTH_Tnp_4 | 0.94 |
| PF02796 | HTH_7 | 0.94 |
| PF12760 | Zn_Tnp_IS1595 | 0.94 |
| PF03400 | DDE_Tnp_IS1 | 0.94 |
| PF11172 | DUF2959 | 0.94 |
| PF02899 | Phage_int_SAM_1 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 1.89 |
| COG5464 | Recombination-promoting DNA endonuclease RpnC/YadD | Replication, recombination and repair [L] | 1.89 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.94 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.94 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.94 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.94 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.15 % |
| All Organisms | root | All Organisms | 35.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_103346807 | Not Available | 559 | Open in IMG/M |
| 3300005172|Ga0066683_10390011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria → unclassified Parcubacteria → Candidatus Parcubacteria bacterium | 862 | Open in IMG/M |
| 3300005180|Ga0066685_10490417 | Not Available | 851 | Open in IMG/M |
| 3300005187|Ga0066675_10643497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria → unclassified Parcubacteria → Candidatus Parcubacteria bacterium | 796 | Open in IMG/M |
| 3300005332|Ga0066388_100525339 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300005332|Ga0066388_102427058 | Not Available | 951 | Open in IMG/M |
| 3300005332|Ga0066388_108482252 | Not Available | 512 | Open in IMG/M |
| 3300005343|Ga0070687_100664017 | Not Available | 724 | Open in IMG/M |
| 3300005441|Ga0070700_100891467 | Not Available | 723 | Open in IMG/M |
| 3300005444|Ga0070694_100725305 | Not Available | 810 | Open in IMG/M |
| 3300005445|Ga0070708_101179231 | Not Available | 717 | Open in IMG/M |
| 3300005446|Ga0066686_10744049 | Not Available | 658 | Open in IMG/M |
| 3300005446|Ga0066686_10767241 | Not Available | 645 | Open in IMG/M |
| 3300005575|Ga0066702_10678634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 615 | Open in IMG/M |
| 3300005617|Ga0068859_100737856 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005617|Ga0068859_101470247 | Not Available | 752 | Open in IMG/M |
| 3300006041|Ga0075023_100113151 | Not Available | 955 | Open in IMG/M |
| 3300006049|Ga0075417_10603111 | Not Available | 559 | Open in IMG/M |
| 3300006194|Ga0075427_10074330 | Not Available | 608 | Open in IMG/M |
| 3300006794|Ga0066658_10429362 | Not Available | 719 | Open in IMG/M |
| 3300006796|Ga0066665_11013721 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006844|Ga0075428_101089978 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006846|Ga0075430_100396286 | Not Available | 1139 | Open in IMG/M |
| 3300006847|Ga0075431_101696624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300006852|Ga0075433_11779699 | Not Available | 530 | Open in IMG/M |
| 3300006853|Ga0075420_101635897 | Not Available | 552 | Open in IMG/M |
| 3300006853|Ga0075420_101834346 | Not Available | 519 | Open in IMG/M |
| 3300007076|Ga0075435_101557322 | Not Available | 580 | Open in IMG/M |
| 3300007255|Ga0099791_10481593 | Not Available | 602 | Open in IMG/M |
| 3300007255|Ga0099791_10580277 | Not Available | 547 | Open in IMG/M |
| 3300007258|Ga0099793_10063921 | Not Available | 1651 | Open in IMG/M |
| 3300009012|Ga0066710_102173148 | Not Available | 812 | Open in IMG/M |
| 3300009038|Ga0099829_11114392 | Not Available | 654 | Open in IMG/M |
| 3300009089|Ga0099828_10663415 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 937 | Open in IMG/M |
| 3300009089|Ga0099828_10893084 | Not Available | 794 | Open in IMG/M |
| 3300009090|Ga0099827_10347479 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300009090|Ga0099827_11458270 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009094|Ga0111539_11781258 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 714 | Open in IMG/M |
| 3300009094|Ga0111539_12311704 | Not Available | 624 | Open in IMG/M |
| 3300009100|Ga0075418_10488163 | Not Available | 1321 | Open in IMG/M |
| 3300009100|Ga0075418_11346186 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009100|Ga0075418_11368828 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300009100|Ga0075418_11966737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
| 3300009137|Ga0066709_102241698 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009156|Ga0111538_11499059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300009156|Ga0111538_12149878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter → Dictyobacter formicarum | 701 | Open in IMG/M |
| 3300009162|Ga0075423_10605049 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1155 | Open in IMG/M |
| 3300009553|Ga0105249_11532202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella | 739 | Open in IMG/M |
| 3300009792|Ga0126374_11821656 | Not Available | 509 | Open in IMG/M |
| 3300009812|Ga0105067_1084934 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010029|Ga0105074_1054499 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010043|Ga0126380_11718657 | Not Available | 564 | Open in IMG/M |
| 3300010329|Ga0134111_10443300 | Not Available | 562 | Open in IMG/M |
| 3300010359|Ga0126376_10700850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-065 | 974 | Open in IMG/M |
| 3300010366|Ga0126379_11360940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 816 | Open in IMG/M |
| 3300010366|Ga0126379_13123777 | Not Available | 554 | Open in IMG/M |
| 3300010403|Ga0134123_12703736 | Not Available | 564 | Open in IMG/M |
| 3300012096|Ga0137389_10418231 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300012096|Ga0137389_10708287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella lusitana | 865 | Open in IMG/M |
| 3300012096|Ga0137389_10739918 | Not Available | 845 | Open in IMG/M |
| 3300012096|Ga0137389_11625480 | Not Available | 542 | Open in IMG/M |
| 3300012189|Ga0137388_10284769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1512 | Open in IMG/M |
| 3300012199|Ga0137383_10826124 | Not Available | 676 | Open in IMG/M |
| 3300012201|Ga0137365_10051024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3132 | Open in IMG/M |
| 3300012201|Ga0137365_10514035 | Not Available | 880 | Open in IMG/M |
| 3300012202|Ga0137363_10944131 | Not Available | 732 | Open in IMG/M |
| 3300012202|Ga0137363_11030956 | Not Available | 699 | Open in IMG/M |
| 3300012212|Ga0150985_114972372 | Not Available | 590 | Open in IMG/M |
| 3300012357|Ga0137384_10974780 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012361|Ga0137360_10329356 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012361|Ga0137360_10591311 | Not Available | 950 | Open in IMG/M |
| 3300012362|Ga0137361_10784296 | Not Available | 868 | Open in IMG/M |
| 3300012683|Ga0137398_11268086 | Not Available | 500 | Open in IMG/M |
| 3300012685|Ga0137397_10520795 | Not Available | 886 | Open in IMG/M |
| 3300012927|Ga0137416_10125782 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300012927|Ga0137416_10429766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1125 | Open in IMG/M |
| 3300012930|Ga0137407_10299878 | Not Available | 1469 | Open in IMG/M |
| 3300012971|Ga0126369_10200885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1922 | Open in IMG/M |
| 3300012971|Ga0126369_11943543 | Not Available | 677 | Open in IMG/M |
| 3300015241|Ga0137418_11250553 | Not Available | 520 | Open in IMG/M |
| 3300018056|Ga0184623_10427165 | Not Available | 578 | Open in IMG/M |
| 3300018431|Ga0066655_10746301 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018468|Ga0066662_12233921 | Not Available | 574 | Open in IMG/M |
| 3300021560|Ga0126371_13283150 | Not Available | 547 | Open in IMG/M |
| 3300025961|Ga0207712_10456397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1085 | Open in IMG/M |
| 3300026118|Ga0207675_102516902 | Not Available | 525 | Open in IMG/M |
| 3300026334|Ga0209377_1308342 | Not Available | 528 | Open in IMG/M |
| 3300026537|Ga0209157_1276775 | Not Available | 629 | Open in IMG/M |
| 3300027671|Ga0209588_1270882 | Not Available | 515 | Open in IMG/M |
| 3300027873|Ga0209814_10207377 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300027874|Ga0209465_10448793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 645 | Open in IMG/M |
| 3300027875|Ga0209283_10095196 | Not Available | 1943 | Open in IMG/M |
| 3300028589|Ga0247818_11427871 | Not Available | 500 | Open in IMG/M |
| 3300028673|Ga0257175_1130924 | Not Available | 503 | Open in IMG/M |
| 3300030903|Ga0308206_1034936 | Not Available | 933 | Open in IMG/M |
| 3300031092|Ga0308204_10358611 | Not Available | 504 | Open in IMG/M |
| 3300031093|Ga0308197_10095403 | Not Available | 870 | Open in IMG/M |
| 3300031421|Ga0308194_10275430 | Not Available | 574 | Open in IMG/M |
| 3300031421|Ga0308194_10302374 | Not Available | 554 | Open in IMG/M |
| 3300031681|Ga0318572_10903026 | Not Available | 525 | Open in IMG/M |
| 3300031777|Ga0318543_10381311 | Not Available | 632 | Open in IMG/M |
| 3300031910|Ga0306923_11162920 | Not Available | 827 | Open in IMG/M |
| 3300031942|Ga0310916_10514281 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300031947|Ga0310909_11307595 | Not Available | 583 | Open in IMG/M |
| 3300032174|Ga0307470_11913372 | Not Available | 505 | Open in IMG/M |
| 3300032770|Ga0335085_11681891 | Not Available | 654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1033468073 | 3300000955 | Soil | WTFRAPSLYRHVHRELLRNTSLDFTPIIPATACHQRN |
| Ga0066683_103900111 | 3300005172 | Soil | MAVMWTFREPSLGRHVPHELMRNAVLNLTLIIPATACHQRNYVQRYSRYNVVRNFR* |
| Ga0066685_104904171 | 3300005180 | Soil | MAVMWTFREPSLGRRVPHELMRNAVLNFAPSIPATACHQRKYVQRYSR |
| Ga0066675_106434971 | 3300005187 | Soil | MAVLWTFHESSLYRHVRREFMRNALRDFTPIYPQLLATKE |
| Ga0066388_1005253393 | 3300005332 | Tropical Forest Soil | MAVLWTFLEPSLCRHVLRELMRNAWLDFTPIMPATICHQRN |
| Ga0066388_1024270581 | 3300005332 | Tropical Forest Soil | MAGLWTFHTSSLCRHVHRELMRSGLLDLTLIIPATTCHQRNYAERYSRFMRAMRLWEQRMAR |
| Ga0066388_1084822521 | 3300005332 | Tropical Forest Soil | MAVLSTFRELSLCRQVHGELMRSKLLDLTSIISATVCHQRNYVERYSRS |
| Ga0070687_1006640172 | 3300005343 | Switchgrass Rhizosphere | MAVLWTFREPSLYRHGRREFMRNAMLDLPPILPVTACHQRNYVE |
| Ga0070700_1008914671 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVLWTFREPSLYRHGRREFMRNAMLDLPPILPVTACHQRNYVETYSRY |
| Ga0070694_1007253051 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVLWTFREPSLGRHVHREFMRNAVLNLTLIIPATACHQRNYV |
| Ga0070708_1011792312 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVLWTFRAPSLCRHVRRELLRNTLLDFAPIIPATACHQRNYVETYSRY |
| Ga0066686_107440492 | 3300005446 | Soil | MAVLYTFREPSLGRHVHREFMRSAWLDVTPIIPATACHQRNYVERYSR |
| Ga0066686_107672411 | 3300005446 | Soil | MAVLWTFREPSLCRHVRRELMRNALLDLTPIIPATACHQRNYVETYSR |
| Ga0066702_106786341 | 3300005575 | Soil | VYTFREPSLYRRVPHEFMRNAVLNLTRIIPTTACHQRN |
| Ga0068859_1007378562 | 3300005617 | Switchgrass Rhizosphere | GLSARRMAVLWTFREFSLCRHARRELMRNAWLDFTPIIPVTACH* |
| Ga0068859_1014702472 | 3300005617 | Switchgrass Rhizosphere | GLSARRMAVLWTFREPSLYRHGRREFMRNAMLDLPPILPVTACHQRNYVETYSRYMA* |
| Ga0075023_1001131511 | 3300006041 | Watersheds | MAVLSTLREPSLGRQMHRELLRNVLLDLTTIMPATTYHRRSYAERYSR |
| Ga0075417_106031111 | 3300006049 | Populus Rhizosphere | MAVLWTFREPSLGRHVHRELLRNAWLYFALSIPATACHLRNYVETYSKS |
| Ga0075427_100743301 | 3300006194 | Populus Rhizosphere | MAVLVTFCEPSLGRHVHRELMRSVWLDVTPKILATAYHQRNYVERYSRYRD |
| Ga0066658_104293621 | 3300006794 | Soil | MAVLWTFREPSLCRRVHRALMRNALLDYTPIQPATAC |
| Ga0066665_110137211 | 3300006796 | Soil | MAVLWTFREPSLCRHGRRELLRNAWLDFTPSIPATACQQRHDVETYSRFIDNALYACY |
| Ga0075428_1010899782 | 3300006844 | Populus Rhizosphere | MAVLYTFRKSSPCRHVHREFMRSAVLDLTPIIPATACHQSNYVERYSR |
| Ga0075430_1003962861 | 3300006846 | Populus Rhizosphere | MAVVWPVREPSLGRQVHREFLRNAWLDVALRIPATACHQRNYVERYS |
| Ga0075431_1016966242 | 3300006847 | Populus Rhizosphere | MLSTFRAPSLCRRVHRELLRSAVLDLIPIIAATACHQRNYVERYSRYR |
| Ga0075433_117796991 | 3300006852 | Populus Rhizosphere | LRAPSLYRHVHREFMRSAGLDVILIIPVTVCHQRNYVERY |
| Ga0075420_1016358972 | 3300006853 | Populus Rhizosphere | MVALWTFRKLSLCRHVRREFMRNAWPDFTPIIAATACHQRNYFET |
| Ga0075420_1018343461 | 3300006853 | Populus Rhizosphere | MAVVWPVREPSLGRQVHREFLRNAWLDVALRIPATACHQRNYVERYSR |
| Ga0075435_1015573221 | 3300007076 | Populus Rhizosphere | MAVLWTFREPSLGRHVHRELLRNAWLYFALSIPATACHLRNYVETYSKSIQANSMWI |
| Ga0099791_104815932 | 3300007255 | Vadose Zone Soil | LWTFRESSLGRYVHREFMRKAALNLPLIMPVTAFHQRNY |
| Ga0099791_105802771 | 3300007255 | Vadose Zone Soil | MAVLWTFREPSLCRHVRRELMRNTLLDFTPIIPTTACHQRNYVETYSRS |
| Ga0099793_100639211 | 3300007258 | Vadose Zone Soil | MAVLCTFRELSLCRHLRRALMRNTLLNFTPIIPATACHQRNDVETYSRFIKRQTI |
| Ga0066710_1021731481 | 3300009012 | Grasslands Soil | MAVMWTFREPSLGRRVPHELMRNAVLNFAPSIPATACHQRKYVQ |
| Ga0099829_111143921 | 3300009038 | Vadose Zone Soil | MAVLWMFREPSLCRHVRRELLRNAWLDFAPNIPTTACHQSNYVETYSR |
| Ga0099828_106634152 | 3300009089 | Vadose Zone Soil | MAVFGTFRKPSLCRHVHCELMRNALLDLTPIVHATAYYQRSYVETYSRF |
| Ga0099828_108930841 | 3300009089 | Vadose Zone Soil | MAVLWTFREPSLGRRVPHELMRNAVLNLTLIIPATACHQRNYV |
| Ga0099827_103474792 | 3300009090 | Vadose Zone Soil | MAVWWTFREPSLCRHVHREFMRNAVLDLTPIIPATACHQRNYVERYSRFMTG* |
| Ga0099827_114582701 | 3300009090 | Vadose Zone Soil | MAVLSTFREPSLCRHGHCEFMRSAWLDVTPSIPATACHQRNDVERYSRYN |
| Ga0111539_117812582 | 3300009094 | Populus Rhizosphere | MAVLYTFRAPSLGRHVHRELLRSVLLALIPKIPATACHQRNYVER |
| Ga0111539_123117041 | 3300009094 | Populus Rhizosphere | MFREPSLCRHVHRELLRSTLLDLAPIISATACHQRNYVERYSRSMGLWAKSVVIF |
| Ga0075418_104881632 | 3300009100 | Populus Rhizosphere | SARRMAVLWTFREPFPCRHVRRELLRNAWLAVTPIISATACLHRKYVERYRRSKGLVP* |
| Ga0075418_113461862 | 3300009100 | Populus Rhizosphere | MAVLWTFREPLLRRHVRHELLRNAWLDFTPIIPATVCY* |
| Ga0075418_113688282 | 3300009100 | Populus Rhizosphere | MAVLSTFREPSLCRQVHREFMRNAVLDLTPIIPATACHQRNYIERYSRFNWIETT |
| Ga0075418_119667372 | 3300009100 | Populus Rhizosphere | MLSTFRAPSLCRRVHRELLRSAVLDLIPIIAATACHQRNYVERYSRYSS |
| Ga0066709_1022416981 | 3300009137 | Grasslands Soil | ARRMAVLYTFRELPLYRHVRREFMRNALLDFTPILPATACRQRNYVERYSRFTSY* |
| Ga0111538_114990591 | 3300009156 | Populus Rhizosphere | MAVLWTFREPSLCRQGHRAFMRSALLDVTPIIPAIACHQRNDVERYSRS |
| Ga0111538_121498782 | 3300009156 | Populus Rhizosphere | AVLWTFREPLLRRHVRHELLRNAWLDFTPIIPATVCY* |
| Ga0075423_106050491 | 3300009162 | Populus Rhizosphere | MAVLYAFDKPVLRRHVHCELMRSALFDMLPIMPTTACHQRNYVERY |
| Ga0105249_115322021 | 3300009553 | Switchgrass Rhizosphere | MAVWWTFREPSLGRHVLHEFMRNAVLNLTRIIPTTAYQG |
| Ga0126374_118216561 | 3300009792 | Tropical Forest Soil | MAVLSTFRELSLCRHVHRELLRSAVLDVAPIIPATACHQRSYVERYSRYK |
| Ga0105067_10849341 | 3300009812 | Groundwater Sand | MAVWCTFREPSLCRHVHRELMRNAVLDLTPIIPTTACHQSNYVERYSRFMHQSLCIRATDLE |
| Ga0105074_10544991 | 3300010029 | Groundwater Sand | MGVLCTFREPSLGRHVHREFMRKAALNLTLIIPATACHQRNYVERYSR |
| Ga0126380_117186572 | 3300010043 | Tropical Forest Soil | MAVLSTFRELSLRRQVHGELMRSTLLDLPPIIPATSYHQRNYVKRYSRSIRYEPLIPVR |
| Ga0134111_104433001 | 3300010329 | Grasslands Soil | MAVLWTFREPFPCCHVRRELLLNAFLDFTPIIPATACHQRNYVEPYSRFRGIVSG |
| Ga0126376_107008501 | 3300010359 | Tropical Forest Soil | VWWTFREISLCRHVHRELLRSVLLDLTPIIAATACHQRNYVERY |
| Ga0126379_113609402 | 3300010366 | Tropical Forest Soil | MAVLWTCREPSLCRHVRREFMRNAWLDFTLIIPAIACHQRNYV |
| Ga0126379_131237771 | 3300010366 | Tropical Forest Soil | MAVLWTFRAPSLCRHVRREFMRNAWLDFTPSIPATACHQRNYVETYSRFNRDQLK |
| Ga0134123_127037361 | 3300010403 | Terrestrial Soil | MAVLWTFREPSLGCHVCRGFMRNALLDFTPIIPATACHQRNYAERYSR |
| Ga0137389_104182311 | 3300012096 | Vadose Zone Soil | MAVLLTFREPSLCRHVRREFMRKVLLDFTLILPVTICHQGSYVETYS |
| Ga0137389_107082871 | 3300012096 | Vadose Zone Soil | MAVLYTFRAPSLCRHVHREFMRNALLDLTPIIPTTACHQRNYVKTYSR |
| Ga0137389_107399181 | 3300012096 | Vadose Zone Soil | MAVLSMFREPSLCRHVHRECMRSALLDVTPLISATACHQKNYVERYSRSKS |
| Ga0137389_116254801 | 3300012096 | Vadose Zone Soil | MAVWWTFRAPSLGRHVPHEFMRNAVLDLTPIVSATAYHQRNYVETYSR |
| Ga0137388_102847693 | 3300012189 | Vadose Zone Soil | MAGLYTFREPSLGRQVHREFMRSAGLDVTPSIPATACHQRN |
| Ga0137383_108261242 | 3300012199 | Vadose Zone Soil | MAVVWTFREPSLGRHGRRAFMRNAWFDCTPRACLQ |
| Ga0137365_100510241 | 3300012201 | Vadose Zone Soil | MAVLCTFCEPSLRRHEHRELMRNAVLDLTPIIPATSCHQRNYVERYSRYK |
| Ga0137365_105140351 | 3300012201 | Vadose Zone Soil | MLWTFHALSLCRHVYRELLRSAVLDVHPIIPATACHQRNYVERYSR |
| Ga0137363_109441313 | 3300012202 | Vadose Zone Soil | RMAVLYTFREPSLGRQMHREFMRNALLDLTTIMPATTCHRRSYVETYSRSIVAARNMVVQ |
| Ga0137363_110309562 | 3300012202 | Vadose Zone Soil | MAVLCRFHEPSLCRHVHYEFMRSALLDLTPIMPATA |
| Ga0150985_1149723721 | 3300012212 | Avena Fatua Rhizosphere | MAVLWTFHEPSLYRHVRREFMRNALRDFTSIIPATACHQSNYF |
| Ga0137384_109747802 | 3300012357 | Vadose Zone Soil | MAVLWTFREPSLGRHVRRELLRNALLDCTPIIPATACHQRNDVETYSRFRL |
| Ga0137360_103293561 | 3300012361 | Vadose Zone Soil | MAGLYTFREPSLGRQVHRELLRSAWLDLIPIMAATAYHQRNYV |
| Ga0137360_105913112 | 3300012361 | Vadose Zone Soil | MAVLWTFHEPSLCRHVRREFMRNAWLDFTPIIPATACHQRNYVEAYSRFRGLE |
| Ga0137361_107842962 | 3300012362 | Vadose Zone Soil | MAVLWTFREFSLCRHVRRELMRNAWLDFTPIIPVTACHQS |
| Ga0137398_112680861 | 3300012683 | Vadose Zone Soil | MAVLWMFREPSLGRQVRREFMRNAVLDFTPIIPATAC |
| Ga0137397_105207951 | 3300012685 | Vadose Zone Soil | MAVLWTFREFSLCRHVRRELMRNGLRDFTPIIPACACHQRNYVETYSRFKLCSPDYETYT |
| Ga0137416_101257824 | 3300012927 | Vadose Zone Soil | MAVLWTFREFSLCRHARRELMRNAWLDFTPIIPVTACHQRNYVETYGR |
| Ga0137416_104297661 | 3300012927 | Vadose Zone Soil | MAVLWTFHAPSLCRHVRRELLRNAWRDFTPIIPTTACQQRNYIESYSRSMKWS |
| Ga0137407_102998781 | 3300012930 | Vadose Zone Soil | MAVLYAFREPSLEPQGHRELLRSAGLDVAPRIPATACRQRNYLERYSRYKTLESNKSVGG |
| Ga0126369_102008851 | 3300012971 | Tropical Forest Soil | MAVLSTFRELSLCRHVHRELLRSAVLDVAPIIPATACHQRSYVERYSRFT |
| Ga0126369_119435433 | 3300012971 | Tropical Forest Soil | MAGLSTFRAPSLCRHVHRELLCSVVLDVPSIIAATVCHQRNYVERYSRYN |
| Ga0137418_112505531 | 3300015241 | Vadose Zone Soil | MAMLWTFHARSLCRHVYRELMRSAGLNLTPIILVTAYHRRSYAERYSRSITGTRVI |
| Ga0184623_104271652 | 3300018056 | Groundwater Sediment | MAVWWTFREPSLCRHVRREFMRIAWLDFTPIIPTT |
| Ga0066655_107463012 | 3300018431 | Grasslands Soil | RMTVLCTFREPSLCRHVHRELLRSVLLDLTPIIATTACHQRNYVERYSRYRVAME |
| Ga0066662_122339212 | 3300018468 | Grasslands Soil | MAVLYTFHEPSLGRPVHHELMRSALLDVTPIIAATACHQRNYVER |
| Ga0126371_132831502 | 3300021560 | Tropical Forest Soil | MAVLWTFREPSLCRHVHRELLRSAVLDLTARIPTTACHQRNDVERDSRSI |
| Ga0207712_104563973 | 3300025961 | Switchgrass Rhizosphere | MAVLWTFREPSLYRHGRREFMRNAMLDLPPILPVTA |
| Ga0207675_1025169022 | 3300026118 | Switchgrass Rhizosphere | MAVLSPFRAPSLDRHVHHELLRSAVLDVTPKLPATACHQRHDVERYSRSMS |
| Ga0209377_13083421 | 3300026334 | Soil | MAVLYTFREPSLCRHVHREFLRSAWLDVPPIIPATAYHQRNYVERYSRFTA |
| Ga0209157_12767751 | 3300026537 | Soil | MAVLYTFREPSLGRQVHRELMRSALLDLTPIIPATVCHQRNYVERYSRFID |
| Ga0209588_12708821 | 3300027671 | Vadose Zone Soil | MAVLYTFREPSLGRQMHRELMRNALLDLTTIMPATAYHRRSYAERY |
| Ga0209814_102073771 | 3300027873 | Populus Rhizosphere | MAVLWTFREPSLGRHVHRELLRNAWLYFALSIPATACHLRNYVETYSKSI |
| Ga0209465_104487931 | 3300027874 | Tropical Forest Soil | MGVLWTFREPSLGRRVHRALMRNALLDYTPIIPATSCHQSSY |
| Ga0209283_100951961 | 3300027875 | Vadose Zone Soil | MAVLWTFREPSLGRHVRRELMRNAVLDLTPSIPATACQQRNYIEP |
| Ga0247818_114278711 | 3300028589 | Soil | MAVLYTFHEPSLGRPVHHELMRSAVLDVTPIIPSTACRQRNYVERYS |
| Ga0257175_11309241 | 3300028673 | Soil | MAVFWTFRKPSLGRHVHRELLRNALLDVTPIVPATAYRQRSYVETYSRYMEKPY |
| Ga0308206_10349361 | 3300030903 | Soil | MAVLWTFREPSLCRHVHREFMRNAVLDLPPIIPATACHQRNYIE |
| Ga0308204_103586112 | 3300031092 | Soil | MAVLWTFHAPSLGRQGHREFMRSAWLDVTPIIPATACRQRNYVER |
| Ga0308197_100954032 | 3300031093 | Soil | MAVLSTFRELSLCRPVHHEFMRSAVLDVIPIIAATACHQRNYVERYSRYIYGVSKNLRA |
| Ga0308194_102754301 | 3300031421 | Soil | MAVLSTFRASSLCRHVHRALLRSGLLDLTPIIPATTCHQSNYVEIYSRFKAFTSHYFRHVRP |
| Ga0308194_103023741 | 3300031421 | Soil | MAVLCTFREPSLCRQVHREFMRSAWLDLTPIIPVTACHQRNYVEKYSR |
| Ga0318572_109030261 | 3300031681 | Soil | MAVLWTFREPSLCRHVCGELLRNALRDFAPIIPATTCQ |
| Ga0318543_103813112 | 3300031777 | Soil | MAVLETFRAPSLCRHVYRAFLRSVVLDVTPIISATACHQSHDVERYSR |
| Ga0306923_111629201 | 3300031910 | Soil | MAVLWTFREPSLCRHVCGELLRNALLDFAPIIPATTCQQRNYVETYSRFIQRLD |
| Ga0310916_105142811 | 3300031942 | Soil | MAVLWTFRAPSLGRHVHRECMRNTALDVTLIIPTTACHQSN |
| Ga0310909_113075951 | 3300031947 | Soil | LGTFREPSLCRRVHRAFMRNAWLDYTPILPATACHQSRDVETYSRYRNQMAF |
| Ga0307470_119133721 | 3300032174 | Hardwood Forest Soil | VLWTFRTPSLGRQVRRELMRSALLDLTPIMSAAACHQRNYVERYSRSMDAAD |
| Ga0335085_116818912 | 3300032770 | Soil | VLWTLRAPSLGRYVHRDLMRSALRDLTPIMSTTACHQRNYVERYSRYIA |
| ⦗Top⦘ |