


| Basic Information | |
|---|---|
| Family ID | F093952 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SVREPLRRVNESILQVLSTVTISQMSEEPQEQVLVELRT |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.774 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.868 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.057 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 86.79 |
| PF01592 | NifU_N | 5.66 |
| PF00012 | HSP70 | 2.83 |
| PF01521 | Fe-S_biosyn | 0.94 |
| PF07743 | HSCB_C | 0.94 |
| PF01087 | GalP_UDP_transf | 0.94 |
| PF02082 | Rrf2 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 5.66 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 2.83 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.94 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.94 |
| COG1076 | DnaJ domain-containing protein | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.94 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.94 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.94 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.94 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.94 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.94 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.77 % |
| Unclassified | root | N/A | 46.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10069237 | Not Available | 2615 | Open in IMG/M |
| 3300002560|JGI25383J37093_10182683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 552 | Open in IMG/M |
| 3300004119|Ga0058887_1480185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 635 | Open in IMG/M |
| 3300004119|Ga0058887_1485999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 821 | Open in IMG/M |
| 3300005163|Ga0066823_10006542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1551 | Open in IMG/M |
| 3300005171|Ga0066677_10088886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1618 | Open in IMG/M |
| 3300005293|Ga0065715_10345006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 961 | Open in IMG/M |
| 3300005446|Ga0066686_10972395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 553 | Open in IMG/M |
| 3300005454|Ga0066687_10191661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
| 3300005554|Ga0066661_10169959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1341 | Open in IMG/M |
| 3300005650|Ga0075038_10019352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 594 | Open in IMG/M |
| 3300005764|Ga0066903_109042457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300006102|Ga0075015_100813637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
| 3300006354|Ga0075021_10641362 | Not Available | 680 | Open in IMG/M |
| 3300006914|Ga0075436_101555385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300007265|Ga0099794_10016041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3316 | Open in IMG/M |
| 3300009038|Ga0099829_10672961 | Not Available | 860 | Open in IMG/M |
| 3300009038|Ga0099829_11713742 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009088|Ga0099830_10204134 | Not Available | 1548 | Open in IMG/M |
| 3300009521|Ga0116222_1214808 | Not Available | 829 | Open in IMG/M |
| 3300009553|Ga0105249_12608446 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010098|Ga0127463_1087546 | Not Available | 1012 | Open in IMG/M |
| 3300010858|Ga0126345_1003142 | Not Available | 1486 | Open in IMG/M |
| 3300010880|Ga0126350_10336803 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300011120|Ga0150983_10887690 | Not Available | 1413 | Open in IMG/M |
| 3300011120|Ga0150983_13036160 | Not Available | 1076 | Open in IMG/M |
| 3300011120|Ga0150983_14062113 | Not Available | 877 | Open in IMG/M |
| 3300011271|Ga0137393_10412184 | Not Available | 1157 | Open in IMG/M |
| 3300011271|Ga0137393_11139921 | Not Available | 662 | Open in IMG/M |
| 3300012004|Ga0120134_1081514 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012189|Ga0137388_11519437 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012209|Ga0137379_10507750 | Not Available | 1113 | Open in IMG/M |
| 3300012357|Ga0137384_10028337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 4593 | Open in IMG/M |
| 3300012361|Ga0137360_10716081 | Not Available | 860 | Open in IMG/M |
| 3300012373|Ga0134042_1115227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
| 3300012406|Ga0134053_1246182 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012917|Ga0137395_10181634 | Not Available | 1457 | Open in IMG/M |
| 3300012925|Ga0137419_10853582 | Not Available | 747 | Open in IMG/M |
| 3300012927|Ga0137416_10284372 | Not Available | 1365 | Open in IMG/M |
| 3300012929|Ga0137404_11372685 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012948|Ga0126375_10589621 | Not Available | 847 | Open in IMG/M |
| 3300012971|Ga0126369_12792858 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012976|Ga0134076_10128300 | Not Available | 1025 | Open in IMG/M |
| 3300013306|Ga0163162_10191410 | Not Available | 2173 | Open in IMG/M |
| 3300013306|Ga0163162_12091658 | Not Available | 649 | Open in IMG/M |
| 3300014154|Ga0134075_10176595 | Not Available | 916 | Open in IMG/M |
| 3300015052|Ga0137411_1354314 | Not Available | 6542 | Open in IMG/M |
| 3300015082|Ga0167662_1003999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300015162|Ga0167653_1036305 | Not Available | 908 | Open in IMG/M |
| 3300015374|Ga0132255_105808579 | Not Available | 522 | Open in IMG/M |
| 3300017823|Ga0187818_10025077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2552 | Open in IMG/M |
| 3300017927|Ga0187824_10187251 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300017930|Ga0187825_10025337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1997 | Open in IMG/M |
| 3300017975|Ga0187782_11027258 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300017996|Ga0187891_1287175 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300018007|Ga0187805_10490284 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018020|Ga0187861_10259418 | Not Available | 755 | Open in IMG/M |
| 3300018077|Ga0184633_10464856 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018082|Ga0184639_10074756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1774 | Open in IMG/M |
| 3300020199|Ga0179592_10105001 | Not Available | 1297 | Open in IMG/M |
| 3300020581|Ga0210399_11261643 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300021168|Ga0210406_10862688 | Not Available | 684 | Open in IMG/M |
| 3300021178|Ga0210408_10960055 | Not Available | 663 | Open in IMG/M |
| 3300021178|Ga0210408_11416130 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300021405|Ga0210387_10459880 | Not Available | 1130 | Open in IMG/M |
| 3300021433|Ga0210391_10073179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2710 | Open in IMG/M |
| 3300021478|Ga0210402_11753646 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021478|Ga0210402_11762438 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021560|Ga0126371_10990338 | Not Available | 983 | Open in IMG/M |
| 3300022513|Ga0242667_1030691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300022530|Ga0242658_1083911 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300022531|Ga0242660_1088287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300022720|Ga0242672_1122102 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300024330|Ga0137417_1376697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4180 | Open in IMG/M |
| 3300025898|Ga0207692_10820640 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300025898|Ga0207692_10871203 | Not Available | 591 | Open in IMG/M |
| 3300025916|Ga0207663_10739138 | Not Available | 781 | Open in IMG/M |
| 3300025938|Ga0207704_11957518 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026469|Ga0257169_1029048 | Not Available | 818 | Open in IMG/M |
| 3300026490|Ga0257153_1034182 | Not Available | 1049 | Open in IMG/M |
| 3300026550|Ga0209474_10632157 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027654|Ga0209799_1064171 | Not Available | 825 | Open in IMG/M |
| 3300027660|Ga0209736_1012577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2693 | Open in IMG/M |
| 3300027681|Ga0208991_1137519 | Not Available | 725 | Open in IMG/M |
| 3300027684|Ga0209626_1199162 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027819|Ga0209514_10156412 | Not Available | 1209 | Open in IMG/M |
| 3300027835|Ga0209515_10249700 | Not Available | 1023 | Open in IMG/M |
| 3300027867|Ga0209167_10012418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4032 | Open in IMG/M |
| 3300027875|Ga0209283_10025397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 3663 | Open in IMG/M |
| 3300027875|Ga0209283_10716302 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027879|Ga0209169_10406600 | Not Available | 716 | Open in IMG/M |
| 3300027882|Ga0209590_10051983 | Not Available | 2288 | Open in IMG/M |
| 3300027894|Ga0209068_10139470 | Not Available | 1305 | Open in IMG/M |
| 3300027895|Ga0209624_10385247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364 | 934 | Open in IMG/M |
| 3300027905|Ga0209415_10515391 | Not Available | 916 | Open in IMG/M |
| 3300027905|Ga0209415_10691682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364 | 733 | Open in IMG/M |
| 3300028780|Ga0302225_10350636 | Not Available | 696 | Open in IMG/M |
| 3300029993|Ga0302304_10039868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1905 | Open in IMG/M |
| 3300030923|Ga0138296_1304115 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031128|Ga0170823_16184839 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031545|Ga0318541_10876591 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031754|Ga0307475_10096773 | Not Available | 2298 | Open in IMG/M |
| 3300031823|Ga0307478_10614596 | Not Available | 909 | Open in IMG/M |
| 3300031823|Ga0307478_10899926 | Not Available | 741 | Open in IMG/M |
| 3300031897|Ga0318520_10731480 | Not Available | 619 | Open in IMG/M |
| 3300031962|Ga0307479_10511467 | Not Available | 1184 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100692375 | 3300001593 | Forest Soil | LRRVNESILHVLGTVTISQMSEDPQEPALVALQT* |
| JGI25383J37093_101826831 | 3300002560 | Grasslands Soil | CSVREPLRRVNESILQVLSSVTISQMSEDPQEPTLVALQK* |
| Ga0058887_14801852 | 3300004119 | Forest Soil | ATERCSVREPLRRVNESILNVLSTVTISQMSEEPYEPALVALRT* |
| Ga0058887_14859992 | 3300004119 | Forest Soil | SVREPLRRVNESILTVLSTVTIAQMSEEAQEPALVALRA* |
| Ga0066823_100065423 | 3300005163 | Soil | SVREPLRRVNESILNVLNMVTIAQMSEEPQQEHVLVALKA* |
| Ga0066677_100888861 | 3300005171 | Soil | SVKEPLRRVNESILSVLGSVTIAQMSEDPHEPSLVALGT* |
| Ga0065715_103450062 | 3300005293 | Miscanthus Rhizosphere | TDKCSVREPLRRVNESIMQVLSTVTISQMSEDPHEPVLIALSGAVR* |
| Ga0066686_109723952 | 3300005446 | Soil | NCDAASKCSVREPLRRVNESILQVLNTVTISQMCDEPQEQVLVALRA* |
| Ga0066687_101916611 | 3300005454 | Soil | HRCSVKEPLRRVNESILNVLGSVTIAQMSEDPHEPALVALTRT* |
| Ga0066661_101699592 | 3300005554 | Soil | ATSKCSVREPLRRVNDSILNVLGTVTIAHMSEEPQERVLVALKA* |
| Ga0075038_100193521 | 3300005650 | Permafrost Soil | ASDCCTVREPLRRVNESILSVLSNVTISQMSEDQHEHALVELQTT* |
| Ga0066903_1090424571 | 3300005764 | Tropical Forest Soil | TCTVREPLRRVNESIARVLRSVTISQMSEDSPDAELVGLSV* |
| Ga0075015_1008136371 | 3300006102 | Watersheds | TCTVREPLRRVNESIMQVLSTVTISQMSEEPDQPALVQMQS* |
| Ga0075021_106413621 | 3300006354 | Watersheds | PLRRVNESILTVLGTVTIAQMSEEAQEPALVALRA* |
| Ga0075436_1015553852 | 3300006914 | Populus Rhizosphere | KCSVREPLRRVNESILQVLGTVTISQMCDDPQEQVLVALRA* |
| Ga0099794_100160411 | 3300007265 | Vadose Zone Soil | ECGQTSHCTIREPLRRVNESILQVLGAVTISQMSEEPQEGALVALRT* |
| Ga0099829_106729612 | 3300009038 | Vadose Zone Soil | VREPLRRVNESILQVLGTVTISQMSEEPQERALVELRT* |
| Ga0099829_117137421 | 3300009038 | Vadose Zone Soil | PLRRVNESILQVLNTVTISQMSEEPPEASLVGLRT* |
| Ga0099830_102041343 | 3300009088 | Vadose Zone Soil | SVREPLRRVNESILTVLSAVTILQMSEEQHEPALVALRT* |
| Ga0116222_12148081 | 3300009521 | Peatlands Soil | VREPLRRVNESIMQVLRNVTISQMSDDTAGELVELSN* |
| Ga0105249_126084461 | 3300009553 | Switchgrass Rhizosphere | KCSVREPLRRVNESIMQVLSTVTISQMCDDPQEQVLVALRA* |
| Ga0127463_10875462 | 3300010098 | Grasslands Soil | EPLRRVNESILNVLSTVTISQMSEELHEPALVALRT* |
| Ga0126345_10031423 | 3300010858 | Boreal Forest Soil | SVREPLRRVNESILQVLSTVTISQMSEEPQEQVLVELRT* |
| Ga0126350_103368031 | 3300010880 | Boreal Forest Soil | NCGAADKCSVREPLRRVNESILSVLSTVTISHMSEEQHEPVLVELQT* |
| Ga0150983_108876902 | 3300011120 | Forest Soil | VKEPLRRVNESILTVLSTVTISQMSEEPQERTLVALRT* |
| Ga0150983_130361601 | 3300011120 | Forest Soil | EPLRRVNESIIQVLSTVTISQMSEEPQEPVLVELRT* |
| Ga0150983_140621131 | 3300011120 | Forest Soil | TEKCSVREPLRRVNESILNVLGTVTISQMSEEAHESALVELR* |
| Ga0137393_104121842 | 3300011271 | Vadose Zone Soil | CGQTSHCTIREPLRRVNESILQVLGAVTISQMSEEPQEGVLVALRT* |
| Ga0137393_111399212 | 3300011271 | Vadose Zone Soil | LRRVNDSILQVLSMVTISQMSEEPPQSSLVELQG* |
| Ga0120134_10815141 | 3300012004 | Permafrost | TCTVREPLRRVNESIAQVLRSVTILQMAEDSPDAELVGLSI* |
| Ga0137388_115194371 | 3300012189 | Vadose Zone Soil | EPLRRVNESILQVLSTVTISQMSEDPHEPALVELRT* |
| Ga0137379_105077501 | 3300012209 | Vadose Zone Soil | TCTVREPLRKVNESIVQVLRAVSISQMTEDSPEAELVGLPS* |
| Ga0137384_100283371 | 3300012357 | Vadose Zone Soil | NCDATERCSVKEPLRRVNESILNVLSTVTISQMSEELHEPALIALRT* |
| Ga0137360_107160811 | 3300012361 | Vadose Zone Soil | DTTDRCSVREPLRRVNESILHVLGTVTISQMSEEPQERALVELRT* |
| Ga0134042_11152271 | 3300012373 | Grasslands Soil | KEPLRRVNESILNVLGSVTIAQMSEDPHEPSLVALRT* |
| Ga0134053_12461822 | 3300012406 | Grasslands Soil | SVREPLRRVNESILQLLSSVTILQMSEDPQEPTLVALQK* |
| Ga0137395_101816342 | 3300012917 | Vadose Zone Soil | CDASSKCSVLEPLRRVNESVMNVLSTVTIAQMCDEPHEQQMLVALRA* |
| Ga0137419_108535822 | 3300012925 | Vadose Zone Soil | CTVREPLRKVNESIVQVLRAVSILQMSEDSPEVELVGLPS* |
| Ga0137416_102843721 | 3300012927 | Vadose Zone Soil | VREPLRRVNESILNVLSNVTISQMSEEPHERALVELRT* |
| Ga0137404_113726851 | 3300012929 | Vadose Zone Soil | KCSVREPLRRVNESVMNVLSTVTIAQMCDEPHEQQTLVALRA* |
| Ga0126375_105896212 | 3300012948 | Tropical Forest Soil | CDATEKCSVREPLRRVNESILHVLGTVTISQMSDDPQERTLVEIRG* |
| Ga0126369_127928582 | 3300012971 | Tropical Forest Soil | CSVREPLRRVNESILHVLGTVTISQMSDDPQERTLVEIRG* |
| Ga0134076_101283001 | 3300012976 | Grasslands Soil | TPRCSVREPLRRVNESILQVLSSVTISQMSEDPQEPTLVALQK* |
| Ga0163162_101914101 | 3300013306 | Switchgrass Rhizosphere | LRRVNESIMQVLSTVTISQMSEDPHEPVLIALSGAVR* |
| Ga0163162_120916582 | 3300013306 | Switchgrass Rhizosphere | EPLRRVNESIMQVLSTVTISQMCDDPQEQVLVALRA* |
| Ga0134075_101765952 | 3300014154 | Grasslands Soil | TERCSVKEPLRRVNESILSVLGSVTIAQMSEDPHEPTLVALRT* |
| Ga0137411_135431417 | 3300015052 | Vadose Zone Soil | MFGTEPLRRVNRQYFENVLGTVKIAQMSEEPQEQALVAFKA* |
| Ga0167662_10039993 | 3300015082 | Glacier Forefield Soil | STKCSVREPLRRVNESVLQVLNAVTISQMCDEPQEQVLVALQA* |
| Ga0167653_10363051 | 3300015162 | Glacier Forefield Soil | RRHTLIEIGRDTANRREPLRRVNESILSVLGNVTISQMSEDSHEPVLVELRA* |
| Ga0132255_1058085791 | 3300015374 | Arabidopsis Rhizosphere | SKCSVREPLRRVNESIMQVLSTVTISQMCDDPQEQVLVALRA* |
| Ga0187818_100250771 | 3300017823 | Freshwater Sediment | KEPLRRVNESILSVLSAVTISQMSEDPQEPALVALKA |
| Ga0187824_101872512 | 3300017927 | Freshwater Sediment | PLRRVNESIAQVLRSVTISQMLEDSPDPELIGLSV |
| Ga0187825_100253373 | 3300017930 | Freshwater Sediment | AASKCSVREPLRRVNDSIMQVLSTVTIAQMCDEPQEVLVALRA |
| Ga0187782_110272582 | 3300017975 | Tropical Peatland | VREPLRKVNESIVQVLRAVSISQMSEESHEPELVGLR |
| Ga0187891_12871752 | 3300017996 | Peatland | DPLRRVNESILQVLGAVTISQMTEDSPEAELVGLPG |
| Ga0187805_104902841 | 3300018007 | Freshwater Sediment | QSPTCTVREPLRRVNESIMQVLSTVTISQMSEDPDQPALVQMQS |
| Ga0187861_102594182 | 3300018020 | Peatland | REPLRRVNESILQVLRNVTISEMGDESGAAELVELSS |
| Ga0184633_104648561 | 3300018077 | Groundwater Sediment | PLRRVNESILQVLSTVTISQMSEDPQGPALVELRS |
| Ga0184639_100747561 | 3300018082 | Groundwater Sediment | TCTVREPLRRVNDSILQILKTVTISQLSEDSSEPVLVDLPS |
| Ga0179592_101050012 | 3300020199 | Vadose Zone Soil | SSKCSVREPLRRVNESVMNVLSTVTIAQMCDEPHEQQMLVALRA |
| Ga0210399_112616432 | 3300020581 | Soil | QSNTCTVREPLRKVNESIVQVLRAVSISQMTEDSPEAELVGLSS |
| Ga0210406_108626881 | 3300021168 | Soil | RVNESILQVLGTVTISQMSEELQEPALVELRTLGD |
| Ga0210408_109600552 | 3300021178 | Soil | CDATEKCSVREPLRRVNESILTVLSTVTIAQMSEEAQEPALVALRA |
| Ga0210408_114161301 | 3300021178 | Soil | DRCSVREPLRRVNESILHVLGTVTISQMSEEPQETLVALRT |
| Ga0210387_104598801 | 3300021405 | Soil | DATDKCSVREPLRRVNESILQVLSTVTISQMSEDPHEPALVALSLTR |
| Ga0210391_100731795 | 3300021433 | Soil | FVDATEKCSVREPLRRVNESILEVLGSVTISQLSEEPHEQALVALRT |
| Ga0210402_117536462 | 3300021478 | Soil | REPLRKVNESILQVLRAVSISQMSEESPEAELVGLST |
| Ga0210402_117624381 | 3300021478 | Soil | EKCSVREPLRRVNESILTVLGTVTIAQMSEEAQEPALVALRA |
| Ga0126371_109903382 | 3300021560 | Tropical Forest Soil | CDAASKCSVREPLRRVNESILQVLSTVTISQMCDDPQEQVLVALRA |
| Ga0242667_10306912 | 3300022513 | Soil | VREPLRRVNESIAQVLRSVTISQMAEDSPDAELVGLSI |
| Ga0242658_10839112 | 3300022530 | Soil | RKVNDSIMQVLSTVTISQMSEEHHEPALVALSSSPR |
| Ga0242660_10882871 | 3300022531 | Soil | TCTVREPLRKVNESIVQVLRAVSILQMTEDSPEAELVGLPS |
| Ga0242672_11221021 | 3300022720 | Soil | ATDKCSVREPLRRVNESILQVLSTVTISQMSEDPHEPALVALSLTR |
| Ga0137417_13766979 | 3300024330 | Vadose Zone Soil | EPLRRVNESILNVLSTVTISQMSEEPYEPALVALRT |
| Ga0207692_108206401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SVREPLRRVNESILNVLNTVTIAQMSEEPHEQALVALKA |
| Ga0207692_108712032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRRVNESILQVLSTVTISQMSEEPLEPALVELRA |
| Ga0207663_107391382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GAADKCSVREPLRRVNESILSVLSTVTISHMSEEQHEPVLVELQT |
| Ga0207704_119575181 | 3300025938 | Miscanthus Rhizosphere | AASKCSVREPLRRVNESIMQVLSTVTISQMCDDPQEQVLVALRA |
| Ga0257169_10290481 | 3300026469 | Soil | SVREPLRRVNESVMNVLSTVTIAQMCDEPHEQQMLVALRA |
| Ga0257153_10341822 | 3300026490 | Soil | REPLRRVNESVMNVLSTVTIAQMCDEPHEQQMLVALRA |
| Ga0209474_106321572 | 3300026550 | Soil | KCSVREPLRRVNESILNVLSTVTISQMSEELHEPSLVALRT |
| Ga0209799_10641712 | 3300027654 | Tropical Forest Soil | REPLRRVNESIMQVLSTVTIAQMCDDPQEQILVALRA |
| Ga0209736_10125771 | 3300027660 | Forest Soil | PLRRVNESILHVLGTVTISQMSEDPQEPALVALQT |
| Ga0208991_11375192 | 3300027681 | Forest Soil | DRCSVREPLRRVNESIIQVLSTVTISQMSEEPQEPALVELRA |
| Ga0209626_11991621 | 3300027684 | Forest Soil | RCSVREPLRRVNESILQVLSTVTISQMSEESQEQVLVELRT |
| Ga0209514_101564122 | 3300027819 | Groundwater | EPLRKVNDSILQVLSTVTISQMAEEPRSSSVVELRV |
| Ga0209515_102497002 | 3300027835 | Groundwater | EPLRRVNESILQVLSTVTISQMSEEPQEPALVDLRT |
| Ga0209167_100124181 | 3300027867 | Surface Soil | EPLRRVNESVMQVLSTVTISQMCDEPQEQALVALRA |
| Ga0209283_100253978 | 3300027875 | Vadose Zone Soil | REPLRRVNESILSVLSAVTISQMSEEPHEPALVALRT |
| Ga0209283_107163021 | 3300027875 | Vadose Zone Soil | CSVREPLRRVNESILQVLSAVTISQMSEEPHEPELVELRT |
| Ga0209169_104066002 | 3300027879 | Soil | LRKVNESILQVLGTVTISQMSEEHHEPALVALSSALR |
| Ga0209590_100519831 | 3300027882 | Vadose Zone Soil | ATERCSVKEPLRRVNESILSVLGTVTISQMSEDPHEPALVALRT |
| Ga0209068_101394701 | 3300027894 | Watersheds | REPLRRVNESIAQVLRAVTISQMTEDSPDAELVGLTI |
| Ga0209624_103852471 | 3300027895 | Forest Soil | TVREPLRRVNESIAQVLRSVTISQMAEDSPDAELVGLSI |
| Ga0209415_105153912 | 3300027905 | Peatlands Soil | VREPLRKVNESILQVLRAVSISQMSEESPDAELVGLST |
| Ga0209415_106916822 | 3300027905 | Peatlands Soil | EPLRRVNDSILQILKAVTISQMTEGSAERELVDLPS |
| Ga0302225_103506362 | 3300028780 | Palsa | EPLRRVNESILQVLRNVTISEMGDESGAPALVELSS |
| Ga0302304_100398681 | 3300029993 | Palsa | REPLRKVNESILNVLGTVTISQMSEETQEQVLVELR |
| Ga0138296_13041151 | 3300030923 | Soil | ASSKCSVREPLRRVNESVMNVLNTVTIAQMCDEPQEQQMLVPLRA |
| Ga0170823_161848392 | 3300031128 | Forest Soil | DATDRCSVREPLRRVNESILQVLSTVTISQMSEEPQEAALVELRT |
| Ga0318541_108765912 | 3300031545 | Soil | SKCSVREPLRRVNESILQVLSSVTISQMCDDPQEQVLVALRA |
| Ga0307475_100967731 | 3300031754 | Hardwood Forest Soil | PLRRVNESILQVLHTVTISQMCEEPQQEMLVALRA |
| Ga0307478_106145961 | 3300031823 | Hardwood Forest Soil | RCSVREPLRRVNESILHVLGTVTISQMSEEPQEPALVELRT |
| Ga0307478_108999262 | 3300031823 | Hardwood Forest Soil | REPLRRVNESILQILKAVTISQMSDDSREHVLVELPS |
| Ga0318520_107314801 | 3300031897 | Soil | QRCSVKEPLRRVNESILSVLGSVTIAQMSEDPQEPSLVALRT |
| Ga0307479_105114671 | 3300031962 | Hardwood Forest Soil | SVREPLRRVNESILNVLSTVTISQMSEEPHEPSLVALRT |
| ⦗Top⦘ |