


| Basic Information | |
|---|---|
| Family ID | F093948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 8.49 % |
| % of genes near scaffold ends (potentially truncated) | 53.77 % |
| % of genes from short scaffolds (< 2000 bps) | 99.06 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (81.132 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (12.264 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (40.566 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03953 | Tubulin_C | 37.74 |
| PF00091 | Tubulin | 17.92 |
| PF11965 | DUF3479 | 0.94 |
| PF04130 | GCP_C_terminal | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.85 % |
| Unclassified | root | N/A | 14.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10101652 | Not Available | 784 | Open in IMG/M |
| 3300002027|MIS_10157457 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 1639 | Open in IMG/M |
| 3300004642|Ga0066612_1041919 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300004764|Ga0007754_1003965 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines | 588 | Open in IMG/M |
| 3300004769|Ga0007748_10134135 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
| 3300004769|Ga0007748_10199684 | All Organisms → cellular organisms → Eukaryota | 846 | Open in IMG/M |
| 3300004769|Ga0007748_11594439 | All Organisms → cellular organisms → Eukaryota | 1057 | Open in IMG/M |
| 3300004787|Ga0007755_1000677 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300004793|Ga0007760_10076416 | All Organisms → cellular organisms → Eukaryota | 650 | Open in IMG/M |
| 3300004794|Ga0007751_10155405 | All Organisms → cellular organisms → Eukaryota | 1103 | Open in IMG/M |
| 3300004796|Ga0007763_11490683 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens | 780 | Open in IMG/M |
| 3300004810|Ga0007757_11487778 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
| 3300004836|Ga0007759_10200542 | Not Available | 752 | Open in IMG/M |
| 3300005565|Ga0068885_1002022 | All Organisms → cellular organisms → Eukaryota | 658 | Open in IMG/M |
| 3300005595|Ga0066833_10134855 | All Organisms → cellular organisms → Eukaryota | 678 | Open in IMG/M |
| 3300005596|Ga0066834_10283419 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Aschiza → Platypezoidea → Phoridae → Metopininae → Megaseliini → Megaselia → Megaselia scalaris | 521 | Open in IMG/M |
| 3300005660|Ga0073904_10197138 | All Organisms → cellular organisms → Eukaryota | 1177 | Open in IMG/M |
| 3300006355|Ga0075501_1003972 | All Organisms → cellular organisms → Eukaryota | 877 | Open in IMG/M |
| 3300006355|Ga0075501_1098495 | All Organisms → cellular organisms → Eukaryota | 730 | Open in IMG/M |
| 3300006372|Ga0075489_1294876 | All Organisms → cellular organisms → Eukaryota | 913 | Open in IMG/M |
| 3300006646|Ga0099770_1277082 | All Organisms → cellular organisms → Eukaryota | 620 | Open in IMG/M |
| 3300007162|Ga0079300_10194616 | All Organisms → cellular organisms → Eukaryota | 533 | Open in IMG/M |
| 3300007244|Ga0075167_10991334 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila | 1278 | Open in IMG/M |
| 3300007562|Ga0102915_1200973 | All Organisms → cellular organisms → Eukaryota | 647 | Open in IMG/M |
| 3300007636|Ga0102856_1059029 | All Organisms → cellular organisms → Eukaryota | 614 | Open in IMG/M |
| 3300009113|Ga0115926_1001199 | Not Available | 868 | Open in IMG/M |
| 3300009216|Ga0103842_1039423 | Not Available | 558 | Open in IMG/M |
| 3300009247|Ga0103861_10018585 | All Organisms → cellular organisms → Eukaryota | 931 | Open in IMG/M |
| 3300009268|Ga0103874_1002404 | All Organisms → cellular organisms → Eukaryota | 978 | Open in IMG/M |
| 3300009434|Ga0115562_1292470 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
| 3300009436|Ga0115008_11115940 | Not Available | 594 | Open in IMG/M |
| 3300009543|Ga0115099_10179236 | All Organisms → cellular organisms → Eukaryota | 1158 | Open in IMG/M |
| 3300009581|Ga0115600_1081599 | All Organisms → cellular organisms → Eukaryota | 631 | Open in IMG/M |
| 3300009606|Ga0115102_10002791 | All Organisms → cellular organisms → Eukaryota | 579 | Open in IMG/M |
| 3300009677|Ga0115104_10341204 | All Organisms → cellular organisms → Eukaryota | 705 | Open in IMG/M |
| 3300009677|Ga0115104_10782732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1377 | Open in IMG/M |
| 3300010306|Ga0129322_1090445 | All Organisms → cellular organisms → Eukaryota | 1149 | Open in IMG/M |
| 3300012020|Ga0119869_1113132 | All Organisms → cellular organisms → Eukaryota | 840 | Open in IMG/M |
| 3300012408|Ga0138265_1224288 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium | 707 | Open in IMG/M |
| 3300012411|Ga0153880_1453494 | All Organisms → cellular organisms → Eukaryota | 1327 | Open in IMG/M |
| 3300012413|Ga0138258_1499206 | All Organisms → cellular organisms → Eukaryota | 764 | Open in IMG/M |
| 3300012522|Ga0129326_1168803 | All Organisms → cellular organisms → Eukaryota | 974 | Open in IMG/M |
| 3300012711|Ga0157607_1189290 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
| 3300012726|Ga0157597_1062360 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium → Plasmodium (Plasmodium) → Plasmodium knowlesi | 1025 | Open in IMG/M |
| 3300012754|Ga0138278_1014073 | All Organisms → cellular organisms → Eukaryota | 536 | Open in IMG/M |
| 3300012776|Ga0138275_1287547 | All Organisms → cellular organisms → Eukaryota | 911 | Open in IMG/M |
| 3300012780|Ga0138271_1194350 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
| 3300012919|Ga0160422_10573142 | All Organisms → cellular organisms → Eukaryota | 714 | Open in IMG/M |
| 3300013065|Ga0157547_134185 | All Organisms → cellular organisms → Eukaryota | 881 | Open in IMG/M |
| 3300013295|Ga0170791_10888008 | All Organisms → cellular organisms → Eukaryota | 1116 | Open in IMG/M |
| 3300013295|Ga0170791_13875730 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300016681|Ga0180043_118570 | All Organisms → cellular organisms → Eukaryota | 1093 | Open in IMG/M |
| 3300017497|Ga0186404_1027077 | All Organisms → cellular organisms → Eukaryota | 1145 | Open in IMG/M |
| 3300018681|Ga0193206_1025383 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
| 3300018754|Ga0193346_1016113 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300018940|Ga0192818_10241449 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
| 3300018993|Ga0193563_10175813 | All Organisms → cellular organisms → Eukaryota | 712 | Open in IMG/M |
| 3300019022|Ga0192951_10357167 | All Organisms → cellular organisms → Eukaryota | 554 | Open in IMG/M |
| 3300019033|Ga0193037_10276237 | All Organisms → cellular organisms → Eukaryota | 587 | Open in IMG/M |
| 3300019051|Ga0192826_10232899 | All Organisms → cellular organisms → Eukaryota | 679 | Open in IMG/M |
| 3300019055|Ga0193208_10644291 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
| 3300019129|Ga0193436_1070007 | All Organisms → cellular organisms → Eukaryota | 530 | Open in IMG/M |
| 3300019191|Ga0180035_1000130 | All Organisms → cellular organisms → Eukaryota | 1361 | Open in IMG/M |
| 3300020222|Ga0194125_10244340 | All Organisms → cellular organisms → Eukaryota | 1237 | Open in IMG/M |
| 3300021298|Ga0210349_1161023 | All Organisms → cellular organisms → Eukaryota | 1136 | Open in IMG/M |
| 3300021334|Ga0206696_1653871 | All Organisms → cellular organisms → Eukaryota | 1302 | Open in IMG/M |
| 3300021342|Ga0206691_1608705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 511 | Open in IMG/M |
| 3300021342|Ga0206691_1709257 | Not Available | 1259 | Open in IMG/M |
| 3300021345|Ga0206688_11098614 | All Organisms → cellular organisms → Eukaryota | 960 | Open in IMG/M |
| 3300021353|Ga0206693_1160607 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
| 3300021355|Ga0206690_10204491 | All Organisms → cellular organisms → Eukaryota | 1085 | Open in IMG/M |
| 3300021891|Ga0063093_1007341 | All Organisms → cellular organisms → Eukaryota | 776 | Open in IMG/M |
| 3300021947|Ga0213856_1233411 | Not Available | 882 | Open in IMG/M |
| 3300022597|Ga0215185_1126626 | All Organisms → cellular organisms → Eukaryota | 958 | Open in IMG/M |
| 3300023685|Ga0228686_1053401 | Not Available | 556 | Open in IMG/M |
| 3300023700|Ga0228707_1008303 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines | 1464 | Open in IMG/M |
| 3300024484|Ga0256332_1104149 | All Organisms → cellular organisms → Eukaryota | 606 | Open in IMG/M |
| 3300024539|Ga0255231_1047539 | All Organisms → cellular organisms → Eukaryota | 687 | Open in IMG/M |
| 3300024848|Ga0255229_1014256 | All Organisms → cellular organisms → Eukaryota | 1288 | Open in IMG/M |
| 3300026193|Ga0208129_1108892 | All Organisms → cellular organisms → Eukaryota | 538 | Open in IMG/M |
| 3300028113|Ga0255234_1107260 | All Organisms → cellular organisms → Eukaryota | 737 | Open in IMG/M |
| 3300028647|Ga0272412_1075326 | Not Available | 1437 | Open in IMG/M |
| 3300028647|Ga0272412_1083020 | Not Available | 1365 | Open in IMG/M |
| 3300030529|Ga0210284_1350227 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
| 3300030564|Ga0210256_10060390 | All Organisms → cellular organisms → Eukaryota | 562 | Open in IMG/M |
| 3300030594|Ga0210280_1067935 | All Organisms → cellular organisms → Eukaryota | 690 | Open in IMG/M |
| 3300030626|Ga0210291_11170846 | All Organisms → cellular organisms → Eukaryota | 725 | Open in IMG/M |
| 3300030626|Ga0210291_11562820 | Not Available | 850 | Open in IMG/M |
| 3300030738|Ga0265462_10608699 | Not Available | 833 | Open in IMG/M |
| 3300030738|Ga0265462_12647902 | All Organisms → cellular organisms → Eukaryota | 503 | Open in IMG/M |
| 3300030741|Ga0265459_13656101 | Not Available | 539 | Open in IMG/M |
| 3300030777|Ga0075402_10069763 | All Organisms → cellular organisms → Eukaryota | 662 | Open in IMG/M |
| 3300030865|Ga0073972_10000061 | All Organisms → cellular organisms → Eukaryota | 977 | Open in IMG/M |
| 3300030915|Ga0061011_10511897 | Not Available | 607 | Open in IMG/M |
| 3300030938|Ga0138299_10825287 | All Organisms → cellular organisms → Eukaryota | 613 | Open in IMG/M |
| 3300030961|Ga0151491_1315212 | Not Available | 799 | Open in IMG/M |
| 3300031122|Ga0170822_16349313 | All Organisms → cellular organisms → Eukaryota | 955 | Open in IMG/M |
| 3300031447|Ga0272435_1019717 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2 | 3448 | Open in IMG/M |
| 3300031469|Ga0170819_15797169 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 530 | Open in IMG/M |
| 3300031474|Ga0170818_103396254 | All Organisms → cellular organisms → Eukaryota | 524 | Open in IMG/M |
| 3300031474|Ga0170818_104273065 | All Organisms → cellular organisms → Eukaryota | 543 | Open in IMG/M |
| 3300031725|Ga0307381_10179703 | All Organisms → cellular organisms → Eukaryota | 734 | Open in IMG/M |
| 3300032521|Ga0314680_10073819 | All Organisms → cellular organisms → Eukaryota | 1602 | Open in IMG/M |
| 3300032739|Ga0315741_10276403 | All Organisms → cellular organisms → Eukaryota | 1199 | Open in IMG/M |
| 3300032739|Ga0315741_11281201 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 657 | Open in IMG/M |
| 3300032755|Ga0314709_10812607 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.43% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.49% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.66% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.77% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.89% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.89% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.94% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.94% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.94% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.94% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.94% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.94% |
| Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 0.94% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.94% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.94% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.94% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004764 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006372 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006646 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A3_L (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007244 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300009113 | Microbial communities from sand-filter backwash in Singapore swimming pools - SK-1 | Engineered | Open in IMG/M |
| 3300009216 | Microbial communities of water from the North Atlantic ocean - ACM47 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009268 | Eukaryotic communities of water from the North Atlantic ocean - ACM43 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012020 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge | Engineered | Open in IMG/M |
| 3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012413 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012754 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300013065 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES037 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017497 | Metatranscriptome of marine eukaryotic communities from La Jolla, California in f/2 medium with natural seawater and antibiotics, no silicate, 22 C, 21 psu salinity and 636 ?mol photons light - Kryptoperidinium foliaceum CCMP 1326 (MMETSP0120_2) | Host-Associated | Open in IMG/M |
| 3300018681 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164) | Environmental | Open in IMG/M |
| 3300018754 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001810 (ERX1789618-ERR1719236) | Environmental | Open in IMG/M |
| 3300018940 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105) | Environmental | Open in IMG/M |
| 3300018993 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703 | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019033 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080) | Environmental | Open in IMG/M |
| 3300019051 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227) | Environmental | Open in IMG/M |
| 3300019055 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963) | Environmental | Open in IMG/M |
| 3300019129 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975) | Environmental | Open in IMG/M |
| 3300019191 | Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300021298 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.460 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021334 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021891 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022597 | Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T3 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026193 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B (SPAdes) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030564 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030777 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030865 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030915 | Coassembly of Cow X Corn Stover | Host-Associated | Open in IMG/M |
| 3300030938 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030961 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031447 | Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nord | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032521 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032755 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101016523 | 3300000756 | Freshwater And Sediment | MADEFPMKVTAILSPLGGISQMDDFMLFGIHSTKYDEFLL* |
| MIS_101574571 | 3300002027 | Sinkhole Freshwater | MAVELPTKVTAIFKPFGGISQIDDLMLLGIHSTKYDEFLF* |
| Ga0066612_10419192 | 3300004642 | Marine | MAVELPMKVTAIFNPFGGISQMELFMLFGIHSTKYDEFLF* |
| Ga0007754_10039651 | 3300004764 | Freshwater Lake | MAVELPRKVTAIFKPFGGISQIEDLILLGIHSTKYEEFLF* |
| Ga0007748_101341351 | 3300004769 | Freshwater Lake | HFLDAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF* |
| Ga0007748_101996841 | 3300004769 | Freshwater Lake | MAVEFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0007748_115944391 | 3300004769 | Freshwater Lake | MAVEFPKKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0007755_10006772 | 3300004787 | Freshwater Lake | LNISYIAVELPKKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0007760_100764161 | 3300004793 | Freshwater Lake | AVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF* |
| Ga0007751_101554053 | 3300004794 | Freshwater Lake | FEHFLEAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTK* |
| Ga0007763_114906833 | 3300004796 | Freshwater Lake | MAVEFPKKVTAIFNPFGGISQMDDFMLFGIHSTKYEEFLF* |
| Ga0007757_114877781 | 3300004810 | Freshwater Lake | MAVEFPTKVTAILSPLGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0007759_102005422 | 3300004836 | Freshwater Lake | AVELPMKVTAIFNPLGGISQMDDLMLLGIHSTKYEEFLF* |
| Ga0068885_10020222 | 3300005565 | Freshwater Lake | MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF* |
| Ga0066833_101348551 | 3300005595 | Marine | MAVEFPTNVTAIFNPLGGISQIDDLMLLGIHSTKYELFLF* |
| Ga0066834_102834192 | 3300005596 | Marine | MKVTDILRPFGGISQIADLMLFGIHSTKYEEFLF* |
| Ga0073904_101971381 | 3300005660 | Activated Sludge | MAVEFPIKVTAILRPFGGISHIDDLMLFGIHYTK* |
| Ga0075501_10039724 | 3300006355 | Aqueous | MAVELPMKVTAIFNPFGGISQIDDLTLFGIHSTKYDEFLF* |
| Ga0075501_10984952 | 3300006355 | Aqueous | MAVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF* |
| Ga0075489_12948764 | 3300006372 | Aqueous | MAVEFPTKVTAILSPLGGISQMDDLMLLGIHSTK* |
| Ga0099770_12770823 | 3300006646 | Activated Sludge | MAVLFPKKVTAIFNPFGGISQILDLMLFGIHSTKYDEFLF* |
| Ga0079300_101946162 | 3300007162 | Deep Subsurface | MAVELPRKVTAIFNPFGGISQIDDLILLGIHSTK* |
| Ga0075167_109913341 | 3300007244 | Wastewater Effluent | MKVTAIFNPFGGISQMDDLMLFGIHYTKYEEFLF* |
| Ga0102915_12009732 | 3300007562 | Estuarine | VELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF* |
| Ga0102856_10590291 | 3300007636 | Estuarine | IAVEFPRKVADILIPFGGMSQKLVFILFGIHSTK* |
| Ga0115926_10011991 | 3300009113 | Swimming Pool Sandfilter Backwash | MAVVLPTNVDDILSPLGGISQMDDRTLLGIHSTKY |
| Ga0103842_10394232 | 3300009216 | River Water | MKIEAILRPLGGISQTEDLMLLGIHSTKYEEFLFWTLS |
| Ga0103861_100185852 | 3300009247 | River Water | MAVELPTKVTAIFNPFGGISQMDDLMLFGIHSTKYEEFLF* |
| Ga0103874_10024042 | 3300009268 | Surface Ocean Water | MAVEFPTKATAIFNPFGGISQIDDLMLLGIHSTKYEEFLF* |
| Ga0115562_12924701 | 3300009434 | Pelagic Marine | MAVELPKKVTAIFKPLGGISQMDDLMLLGIHSTKYKEFLF* |
| Ga0115008_111159401 | 3300009436 | Marine | LPMKVTAIFNPFGGISQMELFILFGIHSTKYDEFLF* |
| Ga0115099_101792362 | 3300009543 | Marine | YTAVEFPMKVTAIFNPFGGISQIDDLILFGIHSTKYDEFLF* |
| Ga0115600_10815992 | 3300009581 | Wetland | MAVELPTKVTAIFNPFGGISQIDDLILFGIHSTKYEEFLF* |
| Ga0115102_100027911 | 3300009606 | Marine | MAVELPKKVTAIFKPLGGISQMDDLMLLGIHSTKYEEFLF* |
| Ga0115104_103412041 | 3300009677 | Marine | TNVTDILRPLGGISQIAVLILFGIHSTKYEEFLF* |
| Ga0115104_107827322 | 3300009677 | Marine | MAVEFPTNVTDILRPFGGISQIAVLILLGIHSTK* |
| Ga0129322_10904453 | 3300010306 | Aqueous | FPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF* |
| Ga0119869_11131322 | 3300012020 | Activated Sludge | MAVEFPMKVTAIFNPFGGISQMDDLMLFGIHYTKYEEFLF* |
| Ga0138265_12242883 | 3300012408 | Polar Marine | SWMEVEFPTNVDYIFNPFGGMSQTLDLMLFGIHSTN* |
| Ga0153880_14534941 | 3300012411 | Freshwater Sediment | MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF* |
| Ga0138258_14992061 | 3300012413 | Polar Marine | AVELPMKVTDIFKPFGGISQIADLMLFGIHSTKYEEFLF* |
| Ga0129326_11688032 | 3300012522 | Aqueous | FPTKVTAIFNPFGGISQMDDLMLFGIHSTKYELFLF* |
| Ga0157607_11892901 | 3300012711 | Freshwater | MAVELPMKVTAILSPLGGISQMDDLMLLGIHSTK* |
| Ga0157597_10623602 | 3300012726 | Freshwater | MAVELPMKVTAILSPLGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0138278_10140732 | 3300012754 | Freshwater Lake | MAVEFPKKVTAIFNPFGGISQMDDLMLLGIHSTK* |
| Ga0138275_12875472 | 3300012776 | Freshwater Lake | MAVELPRKVTAIFNPFGGISQIDDLILLGIHSTKYEEFLF* |
| Ga0138271_11943501 | 3300012780 | Freshwater Lake | MEVEFPMNVHAIFKPFGGISQIEDLMLLGIHSTKYEEFLFT |
| Ga0160422_105731422 | 3300012919 | Seawater | TDILRPFGGMSQIAHLRLFGIHSTKYDEFLFWTLLV* |
| Ga0157547_1341852 | 3300013065 | Freshwater | AVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF* |
| Ga0170791_108880085 | 3300013295 | Freshwater | EFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF* |
| Ga0170791_138757301 | 3300013295 | Freshwater | MAVEFPKKVTAIFKPFGGISQIDDLILFGIHSTK* |
| Ga0180043_1185701 | 3300016681 | Freshwater | PRKVTAIFNPFGGISQIDDLILLGIHSTKYEEFLF |
| Ga0186404_10270773 | 3300017497 | Host-Associated | ISWIAVELPAKATAIFKPFGGMSQTEALMLFGIHSTK |
| Ga0193206_10253831 | 3300018681 | Marine | PTKATAILRPFGGISQMDDLMLFGIHSTKYEEFLF |
| Ga0193346_10161132 | 3300018754 | Marine | LPTKVTDILRPFGGISQIDDLILFGIHSTKYEEFLF |
| Ga0192818_102414491 | 3300018940 | Marine | VEAILRPLGGMSQTLVITLLGIHSTKYEEFLFCTLS |
| Ga0193563_101758131 | 3300018993 | Marine | MKVADIFKPRGGISQTAVLTLFGIHSTKYEEFLFWMLSIC |
| Ga0192951_103571673 | 3300019022 | Marine | VEFPTKVTAIFNPFGGISQIDDLILLGIHSTKYDEFLF |
| Ga0193037_102762371 | 3300019033 | Marine | MEVLFPKNVTDMSNPAGATVQIDDLMLLGIHSTKY |
| Ga0192826_102328993 | 3300019051 | Marine | MAVEFPTKATAIFNPFGGISQIDDLILLGIHSTKYEEFLF |
| Ga0193208_106442912 | 3300019055 | Marine | MAVEFPTKATAIFNPFGGISQMDDLMLLGIHSTKYDEFLF |
| Ga0193436_10700072 | 3300019129 | Marine | MAVELPTKATAIFNPFGGISQMDDLMLLGIHSTKYEEFLF |
| Ga0180035_10001302 | 3300019191 | Estuarine | MAVELPTNVTDIFKPFGGISQMDDLMLLGIHSTKYDEFLF |
| Ga0194125_102443403 | 3300020222 | Freshwater Lake | LVIAVELPRKVTAILRPLGGISQTAVLILFGIHSTK |
| Ga0210349_11610233 | 3300021298 | Estuarine | AVEFPRNVTAIFNPLGGISQIDDLILLGIHSTKYEEFLF |
| Ga0206696_16538712 | 3300021334 | Seawater | MAVELPMKVTAIFKPFGGISQIDDLMLFGIHSTKYEEFLF |
| Ga0206691_16087051 | 3300021342 | Seawater | MAVEFPTKVTLIFRPLGGMSQMEDLMLLGIHSTKYEEFLF |
| Ga0206691_17092572 | 3300021342 | Seawater | MAVEFPTKATAIFNPFGGISQMEDLMLFGIHSTKYEEFLF |
| Ga0206688_110986143 | 3300021345 | Seawater | VEFPTKATAIFNPFGGISQILDLMLFGIHSTKYEEFLF |
| Ga0206693_11606073 | 3300021353 | Seawater | VEFPTKATAIFNPFGGISQIDDLMLLGIHSTKYEAFLF |
| Ga0206690_102044911 | 3300021355 | Seawater | IAVELPMKVTDILRPFGGISQIADLMLFGIHSTKYEEFLF |
| Ga0063093_10073414 | 3300021891 | Marine | VEFPTKATAIFNPFGGISQMDDLMLLGIHSTKYEEFLF |
| Ga0213856_12334113 | 3300021947 | Watersheds | MAVELPMKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLL |
| Ga0215185_11266262 | 3300022597 | Coral | MAVEFPKKVTAIFNPLGGISQIDDFMLLGIHSTKYDEFLF |
| Ga0228686_10534012 | 3300023685 | Seawater | WTAVEFPRKVTAIFRPFGGMSQTDDLMLFGIHSTKYDEFLF |
| Ga0228707_10083034 | 3300023700 | Freshwater | MAVELPTKVTAILRPFGGISQIDDLMLFGIHSTKYDEFLF |
| Ga0256332_11041491 | 3300024484 | Freshwater | MAVELPTKVTAIFNPFGGISQMDDLMLFGIHSTKYEEFLF |
| Ga0255231_10475392 | 3300024539 | Freshwater | MAVEFPTKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF |
| Ga0255229_10142561 | 3300024848 | Freshwater | MAVELPTNVTDIFKTFGGISQMDDLMLLGIHSTKYDEFLF |
| Ga0208129_11088921 | 3300026193 | Marine | MAVEFPTNVTAIFNPLGGISQIDDLMLLGIHSTKYELFLF |
| Ga0255234_11072601 | 3300028113 | Freshwater | MAVEFPTKVTAIFNPFGGISQMDDLMLFGIHSTKYDEFLF |
| Ga0272412_10753262 | 3300028647 | Activated Sludge | MAVEFPTNVTAIFNPFGGISQIDDLMLLGIHSTKYEEFLF |
| Ga0272412_10830204 | 3300028647 | Activated Sludge | MAVELPTNVTAIFKPFGGISQILDLMLFGIHSTKYDEFLF |
| Ga0210284_13502273 | 3300030529 | Soil | SYIAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF |
| Ga0210256_100603903 | 3300030564 | Soil | VELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF |
| Ga0210280_10679353 | 3300030594 | Soil | MAVEFPKKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLF |
| Ga0210291_111708464 | 3300030626 | Soil | NISYIAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF |
| Ga0210291_115628201 | 3300030626 | Soil | PMKVTDILSPFGGISQIDDLMLLGIHSTNYELSLF |
| Ga0265462_106086993 | 3300030738 | Soil | PMKVTDILSPFGGISQIDDLMLLGIHSTNYELFLF |
| Ga0265462_126479021 | 3300030738 | Soil | MKVTAIFNPFGGISQIDDLMLFGIHSTKYDEFLFYTF |
| Ga0265459_136561011 | 3300030741 | Soil | EVEFAIKVADISSPFGGISQTDDLILLGIQGTKNALFF |
| Ga0075402_100697634 | 3300030777 | Soil | VELPMNVTDIFKPFGGISQIPALMLFGIHSTKYDEFLF |
| Ga0073972_100000613 | 3300030865 | Marine | AVEFPTNVTAIFNPFGGISQILDLMLFGIHSTKYEEFLF |
| Ga0061011_105118972 | 3300030915 | Fungi-Associated Bovine Rumen | RKAVVLPMKVAAILRPRGGISQIDDLTLDGIHSTK |
| Ga0138299_108252872 | 3300030938 | Soil | MAVLLPMNVADIGIPLGGISQIEDLMLFGIHSTNYEEDLVLTENN |
| Ga0151491_13152122 | 3300030961 | Marine | MAVEFPTKATAIFNPFGGISQMDDLMLFGIHSTKYEEFLF |
| Ga0170822_163493133 | 3300031122 | Forest Soil | MEVEFPMKVVDILRPLGGMSQTEDLMLLGIHSTKYVLFLFCTDN |
| Ga0272435_10197171 | 3300031447 | Rock | MKVADIFNPLGGMSQTEDLTLLGIHSMKYEEFLFWT |
| Ga0170819_157971693 | 3300031469 | Forest Soil | LPTNVTAIFKPFGGISQIPALMLFGIHSTKYDEFLF |
| Ga0170818_1033962543 | 3300031474 | Forest Soil | LPMKVTAILSPFGGISQMDDLMLFGIHSTKYELFLF |
| Ga0170818_1042730651 | 3300031474 | Forest Soil | VELPMNVVAILRPFGGMSHTDDLMLLGIHSTNYDEFLF |
| Ga0307381_101797032 | 3300031725 | Marine | MAVEFPTKDTDIFNPFGGISQMDDLMLFGIHSTKYEEFLF |
| Ga0314680_100738191 | 3300032521 | Seawater | MAVVLPRKVTAILRPFGGMSQTDALTLFGIHSTKY |
| Ga0315741_102764032 | 3300032739 | Forest Soil | MAVELPKKVTAIFNPFGGISQIDDLMLFGIHSTKYEEFLF |
| Ga0315741_112812013 | 3300032739 | Forest Soil | ELPMNVTDIFKPFGGISQMDDLMLFGIHSTKYDEFLF |
| Ga0314709_108126071 | 3300032755 | Seawater | VKPQKPTDILRPFGGMSQIAHLRLFGIHSTKYDEFL |
| ⦗Top⦘ |