


| Basic Information | |
|---|---|
| Family ID | F093937 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAIGLSHGGSNVYAATERSRQLWVGTQDGLVLFERGNNGWRE |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.113 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.491 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.245 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.075 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.86% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 14.15 |
| PF13379 | NMT1_2 | 6.60 |
| PF00355 | Rieske | 6.60 |
| PF03992 | ABM | 4.72 |
| PF08450 | SGL | 2.83 |
| PF03972 | MmgE_PrpD | 2.83 |
| PF02826 | 2-Hacid_dh_C | 1.89 |
| PF00149 | Metallophos | 0.94 |
| PF02878 | PGM_PMM_I | 0.94 |
| PF01738 | DLH | 0.94 |
| PF01491 | Frataxin_Cyay | 0.94 |
| PF02457 | DAC | 0.94 |
| PF00389 | 2-Hacid_dh | 0.94 |
| PF13551 | HTH_29 | 0.94 |
| PF02776 | TPP_enzyme_N | 0.94 |
| PF00999 | Na_H_Exchanger | 0.94 |
| PF00753 | Lactamase_B | 0.94 |
| PF13531 | SBP_bac_11 | 0.94 |
| PF12697 | Abhydrolase_6 | 0.94 |
| PF00198 | 2-oxoacid_dh | 0.94 |
| PF01425 | Amidase | 0.94 |
| PF02515 | CoA_transf_3 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 14.15 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 14.15 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 2.83 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.83 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.83 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.94 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.94 |
| COG1965 | Fe-S cluster assembly protein CyaY, frataxin homolog | Inorganic ion transport and metabolism [P] | 0.94 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.94 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.94 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.11 % |
| Unclassified | root | N/A | 1.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_11450532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300000955|JGI1027J12803_103827353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300000956|JGI10216J12902_114034010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300002223|C687J26845_10196578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300003324|soilH2_10304120 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300003999|Ga0055469_10197687 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300004013|Ga0055465_10037051 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300004114|Ga0062593_103209952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300004463|Ga0063356_101843414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 910 | Open in IMG/M |
| 3300004480|Ga0062592_100052388 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300004808|Ga0062381_10311782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300005294|Ga0065705_10395035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300005341|Ga0070691_10060664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1818 | Open in IMG/M |
| 3300005345|Ga0070692_10921352 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005356|Ga0070674_101878487 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005440|Ga0070705_101553967 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005446|Ga0066686_10058590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 2376 | Open in IMG/M |
| 3300005456|Ga0070678_101907839 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005546|Ga0070696_100629742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300005713|Ga0066905_101364280 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 640 | Open in IMG/M |
| 3300005878|Ga0075297_1007823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300006358|Ga0068871_100212991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1672 | Open in IMG/M |
| 3300006358|Ga0068871_102004066 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006845|Ga0075421_102125679 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006854|Ga0075425_100218602 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300006854|Ga0075425_101280823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300006903|Ga0075426_11263525 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300007076|Ga0075435_101694935 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300007255|Ga0099791_10570618 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009100|Ga0075418_11785498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300009162|Ga0075423_12041570 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009807|Ga0105061_1083093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300009811|Ga0105084_1071300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300010320|Ga0134109_10043292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1472 | Open in IMG/M |
| 3300010360|Ga0126372_10318506 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300010364|Ga0134066_10399841 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010366|Ga0126379_11974747 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010373|Ga0134128_10407624 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300010396|Ga0134126_12503566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300010397|Ga0134124_11014959 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010397|Ga0134124_11111490 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300010399|Ga0134127_11250900 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010403|Ga0134123_10090041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2415 | Open in IMG/M |
| 3300012038|Ga0137431_1184036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300012039|Ga0137421_1086960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300012173|Ga0137327_1127118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300012200|Ga0137382_10170221 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300012200|Ga0137382_10777938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → Acidithiobacillus thiooxidans | 688 | Open in IMG/M |
| 3300012210|Ga0137378_10491750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1133 | Open in IMG/M |
| 3300012231|Ga0137465_1186668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300012355|Ga0137369_10631802 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012930|Ga0137407_11900092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300012948|Ga0126375_11404440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300012985|Ga0164308_10109181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1964 | Open in IMG/M |
| 3300014300|Ga0075321_1099706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300014877|Ga0180074_1028730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300014881|Ga0180094_1022943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1229 | Open in IMG/M |
| 3300015200|Ga0173480_11224335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300015372|Ga0132256_100016615 | All Organisms → cellular organisms → Bacteria | 6460 | Open in IMG/M |
| 3300015373|Ga0132257_104204313 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300015374|Ga0132255_106096279 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300016422|Ga0182039_10774618 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300018052|Ga0184638_1006597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3821 | Open in IMG/M |
| 3300018054|Ga0184621_10165627 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300018071|Ga0184618_10009552 | All Organisms → cellular organisms → Bacteria | 2877 | Open in IMG/M |
| 3300018078|Ga0184612_10265768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300018422|Ga0190265_10853398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300018433|Ga0066667_11679254 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300018469|Ga0190270_10653795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300018469|Ga0190270_13428132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300019879|Ga0193723_1081112 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300020060|Ga0193717_1214924 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300020197|Ga0194128_10042496 | All Organisms → cellular organisms → Bacteria | 3486 | Open in IMG/M |
| 3300021082|Ga0210380_10011929 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
| 3300021560|Ga0126371_13239354 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 550 | Open in IMG/M |
| 3300024055|Ga0247794_10318634 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025155|Ga0209320_10020649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3209 | Open in IMG/M |
| 3300025157|Ga0209399_10053404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1662 | Open in IMG/M |
| 3300025159|Ga0209619_10111463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1622 | Open in IMG/M |
| 3300025160|Ga0209109_10077610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1732 | Open in IMG/M |
| 3300025160|Ga0209109_10267608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300025165|Ga0209108_10172999 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300025289|Ga0209002_10681006 | Not Available | 540 | Open in IMG/M |
| 3300025311|Ga0209343_10133907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1987 | Open in IMG/M |
| 3300025318|Ga0209519_10506636 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025322|Ga0209641_10740437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300025968|Ga0210103_1031991 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025996|Ga0208777_1004856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1156 | Open in IMG/M |
| 3300026323|Ga0209472_1107309 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300026464|Ga0256814_1044405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300027526|Ga0209968_1049007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300027552|Ga0209982_1079632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300027765|Ga0209073_10125750 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300027875|Ga0209283_10236704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1211 | Open in IMG/M |
| 3300027907|Ga0207428_10876836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300027907|Ga0207428_11038152 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027979|Ga0209705_10598847 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028807|Ga0307305_10238171 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300031228|Ga0299914_10338885 | Not Available | 1320 | Open in IMG/M |
| 3300031229|Ga0299913_10300679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1591 | Open in IMG/M |
| 3300031720|Ga0307469_10200791 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300031740|Ga0307468_102148083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300031847|Ga0310907_10621587 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031854|Ga0310904_10311548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300033433|Ga0326726_12465779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300034151|Ga0364935_0060644 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.89% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.94% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_114505322 | 3300000787 | Soil | MAIGLSHGGTNVYSASAPSRELWAATQDGLVLFERNANGKWLESRRALR |
| JGI1027J12803_1038273531 | 3300000955 | Soil | MAIGLSHGGNNVYSSNEPSRQLWVGTKDGLVLFERADDGRWRE |
| JGI10216J12902_1140340101 | 3300000956 | Soil | MAIGLSHGGTNVYSAGERSKQLWVATQDGLALFERANDGWRETQRALRGQHISAI |
| C687J26845_101965781 | 3300002223 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDGVVLFERVNGGKWRETRRALRGQHIS |
| soilH2_103041203 | 3300003324 | Sugarcane Root And Bulk Soil | MAIGLSHGGTNVYSAAERSHQLWAATQDGLVLFERESAGKWREARRALRGQHISSIIFERTTGT |
| Ga0055469_101976871 | 3300003999 | Natural And Restored Wetlands | MALGLSHGGTNVYSAAVRSCDLWVATQDGLVLLARSDGGRWCEVRG |
| Ga0055465_100370512 | 3300004013 | Natural And Restored Wetlands | MAIALSHGGTNVYSAPQPSQQLWVGTQDGLVLYERMDNREWREARR |
| Ga0062593_1032099522 | 3300004114 | Soil | MAIGLSHGGTNVYSAGERSNQLWVATQDGLVLFERAGIGQWREAQR |
| Ga0063356_1018434142 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSIGLSHGGSNIYSSAEPSRQLWVATQDGLVLLERNSGADWN |
| Ga0062592_1000523881 | 3300004480 | Soil | MAIGLSHGGTNVYSAPSGSRELWVATQDGLVLFERGEGGHWRES |
| Ga0062381_103117821 | 3300004808 | Wetland Sediment | VAIGLSHGGTNVYSAGERSKQLWVATKDGLVQLERESAGQWREVQRALRGQ |
| Ga0065705_103950352 | 3300005294 | Switchgrass Rhizosphere | MAVGLSHGGTNVYSAGERSHQLWVATQDGLVLFERSRNGWQE |
| Ga0070691_100606643 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLSHGGSNVYSSPERSRELWVGTQDGLVMFTREDSGNWREAHRA |
| Ga0070692_109213522 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLSHGGTNVYSSGETPRQLWVGTQDGLVLFERTSDGQWREAQRALKGQHISSI |
| Ga0070674_1018784872 | 3300005356 | Miscanthus Rhizosphere | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFEREKSGKWREAQRSL |
| Ga0070705_1015539671 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLSHGGTNVYSSGETPRQLWVGTQDGLVLFERAGDGQWR |
| Ga0066686_100585901 | 3300005446 | Soil | MAIGLSHGGTNVYSSNEGSRQLWVSTQDGLVQFERESNGKWREAQRALR |
| Ga0070678_1019078392 | 3300005456 | Miscanthus Rhizosphere | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVMFTREDGGKWREAHRALR |
| Ga0070696_1006297423 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGLSHGGTNVYSSGETPRQLWVGTQDGLVLFERTSDGQWREAQRALK |
| Ga0066905_1013642801 | 3300005713 | Tropical Forest Soil | MAIGLSHGGNNVYASNEPSRQLWVGTKDGLVLFER |
| Ga0075297_10078231 | 3300005878 | Rice Paddy Soil | MAIGLSHGGTNVYLASAPSRELWAATQDGLVLFERNAN |
| Ga0068871_1002129911 | 3300006358 | Miscanthus Rhizosphere | MAIGLSHGGSNVYSSPERSRELWVGTQDGLVMFTREDSGNWREAHRALRGQ |
| Ga0068871_1020040662 | 3300006358 | Miscanthus Rhizosphere | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVMFTREDGGKWREAH |
| Ga0075421_1021256791 | 3300006845 | Populus Rhizosphere | MTIGLSDGGTNVYSKPQASRQLWVATQDGLVLFERA |
| Ga0075425_1002186021 | 3300006854 | Populus Rhizosphere | MAIGLSHGGSNVYSSPEHSQQLWVATKDGIVLIERAAHGQ |
| Ga0075425_1012808231 | 3300006854 | Populus Rhizosphere | MAIGLSHGGNNVYSSNEPSRQLWVGTKDGLVLFERANDG |
| Ga0075426_112635252 | 3300006903 | Populus Rhizosphere | MAVGLSHGGTNVYSSSERSQQLWVGTQDGLVLFERDANGG |
| Ga0075435_1016949351 | 3300007076 | Populus Rhizosphere | MAVGLSHGGSNVYSAPERSRELWVATQDGVVLFERENGKWR |
| Ga0099791_105706182 | 3300007255 | Vadose Zone Soil | MTVGLSHGGTNVYSSSERSQQLWVGTQDGLVLFERDTNGGWRESQRALRG |
| Ga0075418_117854982 | 3300009100 | Populus Rhizosphere | MAIGLSHGGNNVYSSNEPSRQLWVGTKDGLVLFERTNDGRW |
| Ga0075423_120415702 | 3300009162 | Populus Rhizosphere | MAVGLSHGGSNVYSSSERSRELWVATQDGVVLFERENGKWR |
| Ga0105061_10830932 | 3300009807 | Groundwater Sand | MAIGLSHGGTNVYSASERSNQLWVGTQDGLVLFARANGRWREAERALRG |
| Ga0105084_10713002 | 3300009811 | Groundwater Sand | MAIGLSHGGTNVYSASERSDQLWVGTQDGLVRFERTNG |
| Ga0134109_100432921 | 3300010320 | Grasslands Soil | MAIGLSHGGSNVYSSSEQSRQLWVATKDGLVLLERLGDRAWRVSHR |
| Ga0126372_103185061 | 3300010360 | Tropical Forest Soil | MAIGLSHGGNNVYTSNEPSRQLWVGTKDGLVLFERA |
| Ga0134066_103998412 | 3300010364 | Grasslands Soil | MAIGLSHGGSNVYSSSEQSRQLWVATKDGLVLLERLGDRAWRVSH |
| Ga0126379_119747471 | 3300010366 | Tropical Forest Soil | MAVGLSHGGSNVYSAREHSRELWVGSQDGLVLFER |
| Ga0134128_104076241 | 3300010373 | Terrestrial Soil | MAIGLSHGGSNVYSSPERSRELWVGTQDGLVMFTRE |
| Ga0134126_125035662 | 3300010396 | Terrestrial Soil | MAIGLSHGGSNIYSSDEQAGEVWVATKDGAVLLERE |
| Ga0134124_110149593 | 3300010397 | Terrestrial Soil | MAIGLSHGGSNVYSSAERSNDLWVGTQDGLVHFERDGSGKWQEAQRAL |
| Ga0134124_111114902 | 3300010397 | Terrestrial Soil | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVLFERE |
| Ga0134127_112509001 | 3300010399 | Terrestrial Soil | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVLFEREDGGKWR |
| Ga0134123_100900413 | 3300010403 | Terrestrial Soil | MAIGLSHGGTNVYSSTERSHQLWTGTQDGLALFERDNSGKWREAQRAL |
| Ga0137431_11840362 | 3300012038 | Soil | MAIGLSHGGTNVYSAGERSNQLWVATQDGLVLFERAGIGQWREAQRALRGQHI |
| Ga0137421_10869602 | 3300012039 | Soil | MAIGLSHGGTNVYSASERSDQLWVGTQDGIVRFERT |
| Ga0137327_11271181 | 3300012173 | Soil | MAIGLSHGGTNVYSASERSDQLWVGTQDGLVLFARANGQWRETQRA |
| Ga0137382_101702213 | 3300012200 | Vadose Zone Soil | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFEREKSGKWREAQRALRGQH |
| Ga0137382_107779381 | 3300012200 | Vadose Zone Soil | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFEREKSGKWRAAQRALRGQHIS |
| Ga0137378_104917502 | 3300012210 | Vadose Zone Soil | MAIGLSHGGSNVYSSSEQSRQLWVATKDGLVLLERLGDRAW |
| Ga0137465_11866682 | 3300012231 | Soil | MAIGLSHGGSNVYAATERSRQLWVGTQDGLVLFERGAD |
| Ga0137369_106318022 | 3300012355 | Vadose Zone Soil | MAIGLSHGGTNVYSSNEGSTQLWVGTQDGLVQFERESNGKWRE |
| Ga0137407_119000922 | 3300012930 | Vadose Zone Soil | MAIGLSHGGNNVYSSNEPSRQLWVGTKDGLVLFERADDGRWREV |
| Ga0126375_114044401 | 3300012948 | Tropical Forest Soil | MAIGLSHGGNNVYASNEPSRQLWVGTKDGLVLFERADNAKWR |
| Ga0164308_101091813 | 3300012985 | Soil | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVLFEREDGGKWRE |
| Ga0075321_10997062 | 3300014300 | Natural And Restored Wetlands | MAIGLSHGGTNVYSAPERSRQLWVATQDGAVLFERDEQGKWREARRALKDQHISAIIFEPATQTMF |
| Ga0180074_10287301 | 3300014877 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDGLVLYERMDGGKWRD |
| Ga0180094_10229431 | 3300014881 | Soil | MAIGLSHGGTNVYSSPQYSRQLWVGTQDGLVLFEQADNGEWREGQRA |
| Ga0173480_112243351 | 3300015200 | Soil | MAIGLSHGGTNVYSAGERSNQLWVATQDGLVLFERAGIGQWREAQRA |
| Ga0132256_1000166159 | 3300015372 | Arabidopsis Rhizosphere | MAVGLSHGGSNVYSAPERSRELWVATQDGVVLFERENGKW |
| Ga0132257_1042043132 | 3300015373 | Arabidopsis Rhizosphere | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFER |
| Ga0132255_1060962791 | 3300015374 | Arabidopsis Rhizosphere | MAIGLSHGGTNVYTSTERSHQLWAGTQDGLVLFEREKSGKWREAQRS |
| Ga0182039_107746182 | 3300016422 | Soil | MAVGLSHGGSNVYSSPEHSRELWVGSQDGLVLFERDGGGKWRE |
| Ga0184638_10065975 | 3300018052 | Groundwater Sediment | MATGLSHGGTNVYSSKERSRQLWVGTQDGLVLFERGDN |
| Ga0184621_101656271 | 3300018054 | Groundwater Sediment | MATGLSHGGTNVYSSKERSRQLWVATQDGLVLFERGDNGQWREAQRALRGQHIS |
| Ga0184618_100095521 | 3300018071 | Groundwater Sediment | MAVGLSHGGTNVYSSSERSTQLWVGTKDGLVQCERGSNGKWAVAHRALR |
| Ga0184612_102657682 | 3300018078 | Groundwater Sediment | MAIGLSHGGSNVYAATERSRQLWVGTQDGLVLFERGNNGWRE |
| Ga0190265_108533982 | 3300018422 | Soil | MAIGLSHGGTNVYSAPRRSRELWIATQDGLALFERGENGKWRES |
| Ga0066667_116792541 | 3300018433 | Grasslands Soil | MAVGLSHGGTNVYSSSERSQQLWVGTQDGLVLFERDTNGGWRESSPAL |
| Ga0190270_106537951 | 3300018469 | Soil | MAIGLSHGGSNVYASTERSRQLWVGTQDGLVLFERGAD |
| Ga0190270_134281322 | 3300018469 | Soil | MAIGLSHGGSNVYAATERSRQLWVGTQDGLVLFERGADGWREA |
| Ga0193723_10811122 | 3300019879 | Soil | MAVGLSHGGTNVYSSSERSKQLWVGTQDGLVLFER |
| Ga0193717_12149242 | 3300020060 | Soil | MAIGLSHGGTNVYSAKDHSGKLWVGTQDGLVLFERGKDDQWREAQRALKG |
| Ga0194128_100424965 | 3300020197 | Freshwater Lake | MAIGLSHGGSNVYLAPERSRQLWVGTQDGIVLFERNSDGWREAQ |
| Ga0210380_100119291 | 3300021082 | Groundwater Sediment | MAIGLSHGGTNVYSAGERSKQLWVATQDGLALFERGNAGWRETQRALRGQHISAII |
| Ga0126371_132393542 | 3300021560 | Tropical Forest Soil | MAIGLSHGGNNVYTSTEPSRQLWIGTTDGLLLFERANDAR |
| Ga0247794_103186342 | 3300024055 | Soil | MAIGLSHGGSNVYSSPERSRELWVGTQDGLVMFTREDSVNWREA |
| Ga0209320_100206491 | 3300025155 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDSVVLFER |
| Ga0209399_100534041 | 3300025157 | Thermal Springs | MAIGLSHGGSNVYSSPSPSDQVWVGTKDGMVLIER |
| Ga0209619_101114632 | 3300025159 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDSVVLFERVNGGKWR |
| Ga0209109_100776103 | 3300025160 | Soil | MAIGLSHGGTNVYSSKERARQLWIATKDGLVLYERVNGG |
| Ga0209109_102676082 | 3300025160 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDGVVLFERVNGGKWREAQRALRG |
| Ga0209108_101729992 | 3300025165 | Soil | MAIGLSHGGTNVYSSKERTRQLWAATKDGVVLFERAGRGKWQ |
| Ga0209002_106810061 | 3300025289 | Soil | MAIGLSHGGSNVYSSGERSNQLSVATQDGLVLFERADGGR |
| Ga0209343_101339071 | 3300025311 | Groundwater | MAIGLSHGGTNVYSSKERARQLWVATKDSVVLFERVNGGKWRETRRAL |
| Ga0209519_105066361 | 3300025318 | Soil | MAIGLSHGGTNVYSSKERTRQLWAATKDGVVLFERAERGKWQEAR |
| Ga0209641_107404372 | 3300025322 | Soil | MAIGLSHGGTNVYSSKERARQLWVATKDGVVLFERVNGGKW |
| Ga0210103_10319913 | 3300025968 | Natural And Restored Wetlands | MAIGLSHGGTNVYSAGERSNQLWVATQDGLVRFERAGKGQW |
| Ga0208777_10048561 | 3300025996 | Rice Paddy Soil | MAIGLSHGGTNVYLASAPSRELWAATQDGLVLFERNANGKWLESRRALRGEHISSIIFEP |
| Ga0209472_11073091 | 3300026323 | Soil | MAVGLSHGGTNVYSSSERSQQLWVATQDGLVLFERDTNGGWRESQRALRGQHISAI |
| Ga0256814_10444051 | 3300026464 | Sediment | MAIGLSHGGTNVYSAGERSKQLWVATQDGLVLFERGSDGWQEAQRA |
| Ga0209968_10490072 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MAIGLSHGGTNVYSASTPSRELWAATQDGLVLFERDTSGKWQ |
| Ga0209982_10796322 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MAIGLSHGGTNVYSASTPSRELWAATQDGLVLFERDTSGKWQES |
| Ga0209073_101257501 | 3300027765 | Agricultural Soil | MAIGLSHGGSNVYSSAERSGELWVGTQDGLVMFTRDDGGHW |
| Ga0209283_102367041 | 3300027875 | Vadose Zone Soil | MAIGLSHGGSNVYASAGRPRQVWVATQDGLVLLERADGAA |
| Ga0207428_108768362 | 3300027907 | Populus Rhizosphere | MAIGLSHGGNNVYSSNEPSRQLWVGTKDGLVLFERTD |
| Ga0207428_110381522 | 3300027907 | Populus Rhizosphere | MAIGLSHGGSNVYSSTARSGELWVGTQDGLVLFEREDGGKWREA |
| Ga0209705_105988471 | 3300027979 | Freshwater Sediment | MAIGLSHGGTNVYSAANHSRQLWVGTQDGLVLFER |
| Ga0307305_102381711 | 3300028807 | Soil | MAVGLSHGGTNVYSSSERSKQLWVGTQDGLVLFERDTNGGWRESQ |
| Ga0299914_103388851 | 3300031228 | Soil | MAIGLSHGGTNVYSAAARSRQLWVATQDGLVLLERESGGRWRETGRA |
| Ga0299913_103006791 | 3300031229 | Soil | MAIGLSHGGTNVYSGPEPSRQLWVATQDGLVLFERGE |
| Ga0307469_102007913 | 3300031720 | Hardwood Forest Soil | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFERE |
| Ga0307468_1021480831 | 3300031740 | Hardwood Forest Soil | MAIGLSHGGTNVYSASERSKDLWVGTQDGLVRFQRSGNGKWQEAQRALR |
| Ga0310907_106215871 | 3300031847 | Soil | MAIGLSHGGTNVYSSTERSHQLWAGTQDGLVLFEREKSGKWREAQRSLRGQ |
| Ga0310904_103115481 | 3300031854 | Soil | MAIGLSHGGTNVYSADERSYQLWVATQDGLVLFERDGG |
| Ga0326726_124657791 | 3300033433 | Peat Soil | MAIGLSHGGTNVYSASERSKQLWVSTQEGLVLIERASDGRR |
| Ga0364935_0060644_3_110 | 3300034151 | Sediment | MTIGLSHGGTNVYSSGETPRQLWVGTQDGLVLFERA |
| ⦗Top⦘ |