


| Basic Information | |
|---|---|
| Family ID | F093898 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MMRFLVARAVNPQLSLLDGLRDWNGIAAALREPPRKRRRYQGDDLDQFLS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.49 % |
| % of genes near scaffold ends (potentially truncated) | 21.70 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.509 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment (9.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.868 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (20.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.49% β-sheet: 0.00% Coil/Unstructured: 70.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 84.91 |
| PF07729 | FCD | 0.94 |
| PF04255 | DUF433 | 0.94 |
| PF08240 | ADH_N | 0.94 |
| PF05368 | NmrA | 0.94 |
| PF02796 | HTH_7 | 0.94 |
| PF02954 | HTH_8 | 0.94 |
| PF08668 | HDOD | 0.94 |
| PF01066 | CDP-OH_P_transf | 0.94 |
| PF13006 | Nterm_IS4 | 0.94 |
| PF00589 | Phage_integrase | 0.94 |
| PF06961 | DUF1294 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 84.91 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 84.91 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 84.91 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 84.91 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 84.91 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 84.91 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.94 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.94 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.94 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.94 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.94 |
| COG3326 | Uncharacterized membrane protein YsdA, DUF1294 family | Function unknown [S] | 0.94 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.51 % |
| Unclassified | root | N/A | 8.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_106348055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300002127|JGI20164J26629_10038823 | Not Available | 1472 | Open in IMG/M |
| 3300002175|JGI20166J26741_12044836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 727 | Open in IMG/M |
| 3300003858|Ga0031656_10066592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300003858|Ga0031656_10116807 | Not Available | 956 | Open in IMG/M |
| 3300004066|Ga0055484_10038183 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300004180|Ga0066408_1010331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans | 1449 | Open in IMG/M |
| 3300004779|Ga0062380_10042276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300005471|Ga0070698_100684928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300005539|Ga0068853_100049572 | All Organisms → cellular organisms → Bacteria | 3609 | Open in IMG/M |
| 3300005670|Ga0074419_105887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1574 | Open in IMG/M |
| 3300005829|Ga0074479_10872336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1555 | Open in IMG/M |
| 3300006046|Ga0066652_101681915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 579 | Open in IMG/M |
| 3300006417|Ga0069787_10601259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1406 | Open in IMG/M |
| 3300006930|Ga0079303_10223157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 760 | Open in IMG/M |
| 3300006930|Ga0079303_10424766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 566 | Open in IMG/M |
| 3300009075|Ga0105090_10141878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
| 3300009085|Ga0105103_10240035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 977 | Open in IMG/M |
| 3300009091|Ga0102851_10543953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 1202 | Open in IMG/M |
| 3300009167|Ga0113563_11895087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 710 | Open in IMG/M |
| 3300009167|Ga0113563_13883907 | Not Available | 506 | Open in IMG/M |
| 3300009170|Ga0105096_10009994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4530 | Open in IMG/M |
| 3300009180|Ga0114979_10145962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300009527|Ga0114942_1027713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1655 | Open in IMG/M |
| 3300009654|Ga0116167_1057902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1560 | Open in IMG/M |
| 3300009655|Ga0116190_1171023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 758 | Open in IMG/M |
| 3300009664|Ga0116146_1203878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300009796|Ga0105086_101103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. CP45 | 1050 | Open in IMG/M |
| 3300009805|Ga0105079_1019814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 633 | Open in IMG/M |
| 3300009819|Ga0105087_1019774 | Not Available | 964 | Open in IMG/M |
| 3300009839|Ga0116223_10078271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
| 3300010313|Ga0116211_1038120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1380 | Open in IMG/M |
| 3300010344|Ga0116243_10188395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300010366|Ga0126379_12374838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300012094|Ga0136638_10100705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1260 | Open in IMG/M |
| 3300012174|Ga0137338_1119414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 579 | Open in IMG/M |
| 3300012668|Ga0157216_10272364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 783 | Open in IMG/M |
| 3300014319|Ga0075348_1194710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 558 | Open in IMG/M |
| 3300014325|Ga0163163_10212944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1981 | Open in IMG/M |
| 3300014874|Ga0180084_1069517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 717 | Open in IMG/M |
| 3300015084|Ga0167654_1018646 | Not Available | 1132 | Open in IMG/M |
| 3300015216|Ga0182875_10057220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 522 | Open in IMG/M |
| 3300015240|Ga0182876_10054740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 573 | Open in IMG/M |
| 3300018469|Ga0190270_12525262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 576 | Open in IMG/M |
| 3300018481|Ga0190271_10519331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1304 | Open in IMG/M |
| 3300018481|Ga0190271_11244290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 866 | Open in IMG/M |
| 3300019377|Ga0190264_12114897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 521 | Open in IMG/M |
| 3300019767|Ga0190267_10310059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 824 | Open in IMG/M |
| 3300020063|Ga0180118_1312465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1570 | Open in IMG/M |
| 3300020214|Ga0194132_10357420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 757 | Open in IMG/M |
| 3300022209|Ga0224497_10074921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1415 | Open in IMG/M |
| 3300024972|Ga0208626_1015258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1444 | Open in IMG/M |
| 3300025116|Ga0209207_1030831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
| 3300025321|Ga0207656_10573900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 575 | Open in IMG/M |
| 3300025605|Ga0209720_1141030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 588 | Open in IMG/M |
| 3300025613|Ga0208461_1171518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 511 | Open in IMG/M |
| 3300025638|Ga0208198_1169186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 563 | Open in IMG/M |
| 3300026072|Ga0208292_1012166 | Not Available | 1057 | Open in IMG/M |
| 3300026118|Ga0207675_101511325 | Not Available | 692 | Open in IMG/M |
| 3300026349|Ga0256811_1003003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1337 | Open in IMG/M |
| 3300027721|Ga0209492_1240466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 615 | Open in IMG/M |
| 3300027763|Ga0209088_10144444 | Not Available | 1056 | Open in IMG/M |
| 3300027831|Ga0209797_10066834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1588 | Open in IMG/M |
| 3300027831|Ga0209797_10220625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 802 | Open in IMG/M |
| 3300027871|Ga0209397_10038165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
| 3300027885|Ga0209450_10049835 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
| 3300027887|Ga0208980_10163826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
| 3300027887|Ga0208980_10351273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 853 | Open in IMG/M |
| 3300027897|Ga0209254_10118488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2201 | Open in IMG/M |
| 3300027897|Ga0209254_10140518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1987 | Open in IMG/M |
| 3300027897|Ga0209254_10235075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300027900|Ga0209253_10096850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2419 | Open in IMG/M |
| 3300027900|Ga0209253_10327999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300027900|Ga0209253_11157067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 522 | Open in IMG/M |
| 3300027902|Ga0209048_11045872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 519 | Open in IMG/M |
| 3300027904|Ga0209737_10009064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7342 | Open in IMG/M |
| 3300027905|Ga0209415_10246948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
| 3300027975|Ga0209391_10363511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 562 | Open in IMG/M |
| 3300028420|Ga0210366_10025853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1771 | Open in IMG/M |
| 3300028792|Ga0307504_10262028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 637 | Open in IMG/M |
| 3300028802|Ga0307503_10341751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 764 | Open in IMG/M |
| 3300030659|Ga0316363_10024812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3170 | Open in IMG/M |
| 3300030943|Ga0311366_11433360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 593 | Open in IMG/M |
| 3300031521|Ga0311364_11617367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 639 | Open in IMG/M |
| 3300031544|Ga0318534_10101221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1649 | Open in IMG/M |
| 3300031834|Ga0315290_11398912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 572 | Open in IMG/M |
| 3300031954|Ga0306926_12765146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 531 | Open in IMG/M |
| 3300031997|Ga0315278_10489269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300032052|Ga0318506_10069693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1458 | Open in IMG/M |
| 3300032060|Ga0318505_10076130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300032067|Ga0318524_10104862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300032144|Ga0315910_10406994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 1042 | Open in IMG/M |
| 3300032164|Ga0315283_10737583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1059 | Open in IMG/M |
| 3300032770|Ga0335085_10139074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3065 | Open in IMG/M |
| 3300033004|Ga0335084_10028638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5690 | Open in IMG/M |
| 3300033418|Ga0316625_100993682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 746 | Open in IMG/M |
| 3300033482|Ga0316627_100346684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
| 3300033482|Ga0316627_100925653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas campestris | 838 | Open in IMG/M |
| 3300033557|Ga0316617_101343849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 715 | Open in IMG/M |
| 3300034128|Ga0370490_0017136 | Not Available | 2446 | Open in IMG/M |
| 3300034128|Ga0370490_0029191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1832 | Open in IMG/M |
| 3300034158|Ga0370507_0024698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1802 | Open in IMG/M |
| 3300034161|Ga0370513_027405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
| 3300034169|Ga0370480_0250243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300034194|Ga0370499_0013665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1838 | Open in IMG/M |
| 3300034197|Ga0370508_0333732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 9.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 6.60% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 6.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.83% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.83% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.89% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 1.89% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 1.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.89% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Lab-Scale Ebpr Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor | 0.94% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002127 | Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 | Host-Associated | Open in IMG/M |
| 3300002175 | Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 | Host-Associated | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004180 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 10_HOW4 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005670 | Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90104 Phage Sequencing | Engineered | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009796 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_0_10 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010313 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG | Environmental | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015216 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kb | Environmental | Open in IMG/M |
| 3300015240 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kc | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300024972 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 10_HOW4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025116 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025605 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026072 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026349 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027904 | Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| 3300034161 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| 3300034197 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1063480552 | 3300001213 | Wetland | MMRFLLARAVNPQLSLLDGLRNWNHIASGLREGRRKRRYQHDDLDQLLS* |
| JGI20164J26629_100388232 | 3300002127 | Termite Gut | MMRFLLARAVNPAISLLRGLREWNMFAASLREPPRKRRRYQADAWDRFLS* |
| JGI20166J26741_120448361 | 3300002175 | Termite Gut | MMRFLLARAVNPVISLLRGLREWNMFAASLREPPRKRRRYQADAWGR |
| Ga0031656_100665921 | 3300003858 | Freshwater Lake Sediment | MMRFLLARAVNPQLTLLDGLRNWNHVATGLREGRRKRSYQHDDLDQFLS* |
| Ga0031656_101168072 | 3300003858 | Freshwater Lake Sediment | VALMRFLLARAVNPALPLLEGLRSWNQSAAALREAPRKRRYQHDDMDRFLY* |
| Ga0055484_100381832 | 3300004066 | Natural And Restored Wetlands | MRFLVARAVNPQLGLFDGLRQWNGIAAALRESPRKRTYQTDDLDQFLS* |
| Ga0066408_10103312 | 3300004180 | Freshwater Sediment | MMRFLLARAVNPQLSLLDGLRDWNAIAAGLREPPRRRRRYQGDNLERFLS* |
| Ga0062380_100422761 | 3300004779 | Wetland Sediment | MMRFLVARAVNPQLSLHEGLRNWNGIAAALREPTRKRRRYQGDDLERFLS* |
| Ga0070698_1006849282 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRFLLARAVNPSMSLLEGLRAWNLIALALREPPRKRRYQHDNLDQFLS* |
| Ga0068853_1000495724 | 3300005539 | Corn Rhizosphere | MRFLIARAINPHIDLLAGLRNWNQIANSLREPPRKRRGYQLDDLDQFLS* |
| Ga0074419_1058871 | 3300005670 | Lab-Scale Ebpr Bioreactor | MRFLIARAVNPQLTLLDGLRDWNNIAAALREPPRKRRQYQGDNLGEFLS* |
| Ga0074479_108723362 | 3300005829 | Sediment (Intertidal) | MRALLARAVNPDLSLPDALRDWNSIASSLRERPRKRRYQREQLDEFLS* |
| Ga0066652_1016819152 | 3300006046 | Soil | MRFLVSRAVNPQLNLLDGLRGWNGIAASLREPPRKRRRYQGDDLEQFLS* |
| Ga0069787_106012591 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MMRFLIARAVNPQLTLLDGLRDWNNIAAALREPPRKRRQYQGDNLGEFLS* |
| Ga0079303_102231572 | 3300006930 | Deep Subsurface | MRCLVARAVNPQMNLLDGLREWNGIATALREPPRRRRRYQGDDWDQFLS* |
| Ga0079303_104247661 | 3300006930 | Deep Subsurface | MMRFLLARAVNPQLSLLDGLRNWNHIASGLRGGRRKRRYQHDDLDQFLS* |
| Ga0105090_101418782 | 3300009075 | Freshwater Sediment | MMRFLVARAVNPQLSLLDGLRNWNGIAAALREPPRKRRRYQGDDLERFLA* |
| Ga0105103_102400352 | 3300009085 | Freshwater Sediment | MMRFLVARAVNPQLSLLDGLRNWNGIAAALREPPRNRRRYQGDELERFLS* |
| Ga0102851_105439532 | 3300009091 | Freshwater Wetlands | MMRFLLARAVNPQLSLLDGLRNWNHIASGLREGRRKRRYQHDDLDQFLS* |
| Ga0113563_118950872 | 3300009167 | Freshwater Wetlands | MMRFLLARAVNPQISLLDGLRNWNHVASGLREGRRKRMYQHDDLDQFLS* |
| Ga0113563_138839072 | 3300009167 | Freshwater Wetlands | MRFMLARAVNPPGSLLEGLRRWNPMALALREAPRKRRYQYDEMEQFLS* |
| Ga0105096_100099946 | 3300009170 | Freshwater Sediment | MMRFLVARAVNPQLNLLDGLRDWNGIAAALREPPRNRRRYQGDDLERIVS* |
| Ga0114979_101459622 | 3300009180 | Freshwater Lake | MMRFLVARAVNPQLSLRDGLRHWNGIATALREPPRRRRRYQEDDLEQFLS* |
| Ga0114942_10277131 | 3300009527 | Groundwater | MMRFLVARAVNPPLSLLAGLRDWNGTAAALREPPRKRRRYQGDDLEQILS* |
| Ga0116167_10579022 | 3300009654 | Anaerobic Digestor Sludge | MMRFLLARAVNPTTTLRGGLRDWNKLAAALREPPRKRRRYQADARDAFLS* |
| Ga0116190_11710232 | 3300009655 | Anaerobic Digestor Sludge | MMRFLLARAVNPTTTLRGGLRDWNKLAAALREPPRKRRRYQADARDTFLS* |
| Ga0116146_12038782 | 3300009664 | Anaerobic Digestor Sludge | MMRFLIARAVNPQLTLLDGLRDWNNIAAALREPPRKRRRYQGDNLEEFLS* |
| Ga0105086_1011031 | 3300009796 | Groundwater Sand | MMRFLLARAVNPQLSLLDGLRNWNHVASGLREGRRKRTYQH |
| Ga0105079_10198142 | 3300009805 | Groundwater Sand | MMRFLLARAVNPQLSLLDGLRNWNHVASGLREGRRKRRYQHDNLDQLLS* |
| Ga0105087_10197741 | 3300009819 | Groundwater Sand | MMRFLLARAVNPQLSLLDGLRNWNHVASGLREGRRKRTYQHDNLDRFLS* |
| Ga0116223_100782711 | 3300009839 | Peatlands Soil | MMRFLLARAVNPPISLTEGLRTWNRLARDLRERRRRRLYQLDRISEFLC* |
| Ga0116211_10381201 | 3300010313 | Hot Spring | MMRFLLARAVNPSTTLLEGLRDWNKFAAALREPPRKRRRYQADSWDAFLS* |
| Ga0116243_101883952 | 3300010344 | Anaerobic Digestor Sludge | MMRFLVAHAVNPQMSLLDGLRDWNSIAASLREPPRKRRRYQGDALEAFLS* |
| Ga0126379_123748382 | 3300010366 | Tropical Forest Soil | MMRFMLARAVNPPVSLLEGLRMWNPIALALREPPRKRRRYQHDDLDQFLS* |
| Ga0136638_101007053 | 3300012094 | Polar Desert Sand | MRCLVARAVNPQLNLLEGLRQWNAIAAALREPPRRRRQYQGDDWDHFLS* |
| Ga0137338_11194141 | 3300012174 | Soil | MMRFLLARAVNPQLSLLDGLRNWNHVATGLREGRRKRRYQHDDLGQFLS |
| Ga0157216_102723641 | 3300012668 | Glacier Forefield Soil | MMRFLLARAVNPQVSLLEGLRSWNQIATALREPPRKRRRYQHDDLDQFLY* |
| Ga0075348_11947101 | 3300014319 | Natural And Restored Wetlands | MMRFLVARAVNPQLGLFDGLRQWNGIAAALRESPRKCTYQTDDLDQFLS* |
| Ga0163163_102129442 | 3300014325 | Switchgrass Rhizosphere | MRFLIARAINPHIDLLAGLRNWNQIASSLREPPRKRRGYQLDDLDQFLS* |
| Ga0180084_10695172 | 3300014874 | Soil | MMRFLLARAVNPSVSLLEGLRAWNPIALALREPPRKRRYQHDNLEQLLS* |
| Ga0167654_10186462 | 3300015084 | Glacier Forefield Soil | MMRFLVARAVNPQLGLHEGLRQWNSIAASLRESARKRRYQADELETFLS* |
| Ga0182875_100572202 | 3300015216 | Microbial Mat | MRCLVARAVNPQMNLLDGLREWNGIATALREPPRRRRRYQGDDWDRFLS* |
| Ga0182876_100547401 | 3300015240 | Microbial Mat | KRRCHWREFSMMRFLISRAVNPPISLFDGLKTWNRIAHALREPPRKRTYQADRMDDFLC* |
| Ga0190270_125252622 | 3300018469 | Soil | MMRFLVARAVNPQLNLLEGLREWNGIAAALREPPRRRRRYQSDDWWSFLS |
| Ga0190271_105193313 | 3300018481 | Soil | ARAVNPPLSLLDGLRDWNGTAAALREPPRKRRRYQGDDLEQFLS |
| Ga0190271_112442902 | 3300018481 | Soil | MMRFLVARAVNPPLSLLDGLRDWNGTAAALREPPRKRRRYQGDELEQFLS |
| Ga0190264_121148971 | 3300019377 | Soil | MMRFLVARAVNPQLSLLDGLRDWNGIAAALREPPRKRRRYQGDDLDQFLS |
| Ga0190267_103100592 | 3300019767 | Soil | MRFLLARAVNPHISLLEGLRKWNLMASALREAPRKRRRYQHDDLDCFLS |
| Ga0180118_13124654 | 3300020063 | Groundwater Sediment | MMRFLLARAVNPSVSLLEGLRAWNPIALALREPPRKRRYQHDNLDQFLS |
| Ga0194132_103574202 | 3300020214 | Freshwater Lake | MMRFLLSRAVNPAGSLLDALRDWNSIAASLREPSRKKRRYQCDGLKEIL |
| Ga0224497_100749211 | 3300022209 | Sediment | MRFLLARAVNPVISLVEGLRTWNDIARTLRECRRRRQYQNDRISQFLS |
| Ga0208626_10152582 | 3300024972 | Freshwater Sediment | MMRFLLARAVNPQLSLLDGLRDWNAIAAGLREPPRRRRRYQGDNLERFLS |
| Ga0209207_10308312 | 3300025116 | Hot Spring | MMRFLLARAVNPSTTLLEGLRDWNKFAAALREPPRKRRRYQADSWDAFLS |
| Ga0207656_105739001 | 3300025321 | Corn Rhizosphere | MRFLIARAINPHIDLLAGLRNWNQIANSLREPPRKRRGYQLDDLDQFLS |
| Ga0209720_11410302 | 3300025605 | Anaerobic Digestor Sludge | MMRFLLARAVNPTTTLRGGLRDWNKLAAALREPPRKRRRYQA |
| Ga0208461_11715181 | 3300025613 | Anaerobic Digestor Sludge | MMRFLLARAVNPTTTLRGGLRDWNKLAAALREPPR |
| Ga0208198_11691862 | 3300025638 | Anaerobic Digestor Sludge | MMRFLLARAVNPTTTLRGGLRDWNKLAAALREPPRKRRRYQAD |
| Ga0208292_10121661 | 3300026072 | Natural And Restored Wetlands | MMRFLVARAVNPQLGLFDGLRQWNGIAAALRESPRKRTYQTDDLDQFLS |
| Ga0207675_1015113251 | 3300026118 | Switchgrass Rhizosphere | MRFLIARAINPHIDLLVGLRNWNQIASSLREPPRKRRGYQLDDLDQFLS |
| Ga0256811_10030032 | 3300026349 | Sediment | MRFLLARAVNPQASLLEGLRNWNALAAALREPPRRRRYQADTWDEFLS |
| Ga0209492_12404661 | 3300027721 | Freshwater Sediment | MMRFLVARAVNPQLSLLDGLRNWNGIAAALREPPRKRRRYQGDDLERFLA |
| Ga0209088_101444442 | 3300027763 | Freshwater Lake | MMRFLVARAVNPQLSLRDGLRHWNGIATALREPPRRRRRYQEDDLEQFLS |
| Ga0209797_100668342 | 3300027831 | Wetland Sediment | MMRFLVARAVNPQLSLHEGLRNWNGIAAALREPTRKRRRYQGDDLERFLS |
| Ga0209797_102206251 | 3300027831 | Wetland Sediment | MRFLLARAVNPALSLVGGLRAWNDIARSLRERQRRRQY |
| Ga0209397_100381651 | 3300027871 | Wetland | MMRFLLARAVNPQLSLLDGLRNWNHIASGLREGRRKRRYQHDDLDQFLS |
| Ga0209450_100498353 | 3300027885 | Freshwater Lake Sediment | MMRFLLARAVNPQLTLLDGLRNWNHVATGLREGRRKRSYQHDDLDQFLS |
| Ga0208980_101638262 | 3300027887 | Wetland | MMRFLLARAVNPQLSLLDGLRNWNHIASGLREGRRKRRYQHDDLDQLLS |
| Ga0208980_103512732 | 3300027887 | Wetland | MMRFLVARAVNPQLSLLDGLRDWNGIAAALREPPRKRRRYQGDDLERFLS |
| Ga0209254_101184884 | 3300027897 | Freshwater Lake Sediment | MRFLLARAVNPEASLLEGLRNWNALAAALREPPRRRRYQADTWDEFLS |
| Ga0209254_101405183 | 3300027897 | Freshwater Lake Sediment | VALMRFLLARAVNPALPLLEGLRSWNQSAAALREAPRKRRYQHDDMDRFLY |
| Ga0209254_102350752 | 3300027897 | Freshwater Lake Sediment | MMRYLVARAVNPQLSLLDGLRDWNGIAAKLREPPRKRRRYQGDDLEQFLS |
| Ga0209253_100968502 | 3300027900 | Freshwater Lake Sediment | MRFLLARAVNPPLTLVEGLRHWNQMATGLRERPRKRRYQQDDLEQFLS |
| Ga0209253_103279992 | 3300027900 | Freshwater Lake Sediment | MMRFLVARAVNPPISLIDGLRSWRQIANSLREPPRKRRYQQDKLNRFLC |
| Ga0209253_111570672 | 3300027900 | Freshwater Lake Sediment | MMRFLLARAVNPSVSLLEGLRAWNPIALALREPPRKRRYQ |
| Ga0209048_110458721 | 3300027902 | Freshwater Lake Sediment | MRFLLAHAVNPDLSLLEGLRSWNQSAAALREAPRKRRYQHN |
| Ga0209737_100090642 | 3300027904 | Termite Gut | MMRFLLARAVNPAISLLRGLREWNMFAASLREPPRKRRRYQADAWDRFLS |
| Ga0209415_102469482 | 3300027905 | Peatlands Soil | MMRFLLARAVNPPISLTEGLRTWNRLARDLRERRRRRLYQLDRISEFLC |
| Ga0209391_103635112 | 3300027975 | Freshwater Sediment | MMRFLVARAVNPQLNLLDGLRDWSGIAAALREPPRNRRRYQGDELERFLS |
| Ga0210366_100258532 | 3300028420 | Estuarine | MRFLLARAVNPVISLVDGLRTWNDIARTLRECRRRRQYQNDRISQFLS |
| Ga0307504_102620282 | 3300028792 | Soil | MRFLLARAVNPHVSLLESLRKWNLMAYALREAPRKRRRYQQDDLDRCLS |
| Ga0307503_103417511 | 3300028802 | Soil | MMRFFVARAVNPHLSLLEGLRDWNGIAAALREPPRKRRRYQGDDLEQFLS |
| Ga0316363_100248123 | 3300030659 | Peatlands Soil | MMRFLLARAVNPPISLTEGLRTWNRLARDLRERRRRRLYQL |
| Ga0311366_114333601 | 3300030943 | Fen | MMRFLVARAVNPQLSLLDGLRDWNRIAAALRESPRKRRRYQGDDLDQFLS |
| Ga0311364_116173672 | 3300031521 | Fen | MMRFLVARAVNPQLSLLDGLRDWNSIAAALRESPRRRRRYQGDDLEQFLS |
| Ga0318534_101012213 | 3300031544 | Soil | MMRFLLARAVNPSLSLLEGLRAWNPIAHALREPPRKRRYQHDNLEQFLS |
| Ga0315290_113989122 | 3300031834 | Sediment | VALMRFLLAHAVNPDLSLLEGLRSWNQSAAALREAPRKRRYQHDEMDRFLY |
| Ga0306926_127651462 | 3300031954 | Soil | MMRFMLARAVNPPVSLLEGLRMWNTMALALREPPRKRRRYQHDELDQFLS |
| Ga0315278_104892691 | 3300031997 | Sediment | MRFLLAHAVNPDLSLLEGLRSWNQSAAALREAPRKRRYQHDEMDRFLY |
| Ga0318506_100696933 | 3300032052 | Soil | MMRFLLARAVNPSLSLLEGLRAWNPIAHALREPPRKRRYQ |
| Ga0318505_100761302 | 3300032060 | Soil | MMRFLLARAVNPSLSLLEGLRAWNPIAHALREPPRKRRYQHDDLEQFLS |
| Ga0318524_101048621 | 3300032067 | Soil | MMRFLLARAVNPSLSLLEGLRAWNPIAHALREPPRK |
| Ga0315910_104069942 | 3300032144 | Soil | MRFLVARAVNPQKRLIDALRNWNEIAAALREAPRKRQYQHERLEYFLS |
| Ga0315283_107375831 | 3300032164 | Sediment | AHAVNPDLSLLEGLRSWNQSAAALREAPRKRRYPHDEMDRFLY |
| Ga0335085_101390743 | 3300032770 | Soil | MMRFLLARAVNPSLSLLQGLRAWNPIAHALREPPRKRQYQHDNLEQFLS |
| Ga0335084_100286383 | 3300033004 | Soil | MRFLLARAVNPQLSLLEGLHRWNQIATALREAPRKRRRYQLDDLDRFLS |
| Ga0316625_1009936821 | 3300033418 | Soil | MMRFLLARAVNPQISLLDGLRNWNHVASGLREGRRKRMYQHDELDQLLS |
| Ga0316627_1003466842 | 3300033482 | Soil | MRFMLARAVNPPGSLLEGLRRWNPMALALREAPRKRRYQHDEMEQ |
| Ga0316627_1009256531 | 3300033482 | Soil | MRCLVARAVNPQMNLLDGLREWNGIATALREPPRRRRRYQGDDWDHFL |
| Ga0316617_1013438492 | 3300033557 | Soil | MMRFLLARAVNPQISLLDGLRNWNHVASGLREGRRKRMYQHDDLDQFLS |
| Ga0370490_0017136_1527_1715 | 3300034128 | Untreated Peat Soil | MMRFLVTRAVNPQLSLLDGLRNLNGIAAALREPPRKRRRYQGDDLERFLSQRLCPPRHAASR |
| Ga0370490_0029191_66_215 | 3300034128 | Untreated Peat Soil | MRCLVARAVNPQMNLLDGLREWNGIATALREPPRRRRRYQGDDWDQFLS |
| Ga0370507_0024698_2_136 | 3300034158 | Untreated Peat Soil | MRCLVARAVNPQMNLLDGLREWNGIATALREPPRRRRRYQGDDWD |
| Ga0370513_027405_1356_1505 | 3300034161 | Untreated Peat Soil | MRFLVARAVNPQVSLLQGLRDWNGIADALREPPRKRRRYQGDDLDQFLS |
| Ga0370480_0250243_407_595 | 3300034169 | Untreated Peat Soil | MMRFLVTRAVNPQLSLLDGLRNWNGIAAALREPPRKRRRYQGDDLERFLSQRLCPPRHAASR |
| Ga0370499_0013665_179_370 | 3300034194 | Untreated Peat Soil | MMRFLVTRAVNPQLSLLDGLRNLNGIAAALREPPRKRRRYQGDDLERFLSQRLCPPPRHAASR |
| Ga0370508_0333732_2_127 | 3300034197 | Untreated Peat Soil | MMRFLISRAVNPPISLFDGLKTWNRIAHALREPPRKRTYQAD |
| ⦗Top⦘ |