


| Basic Information | |
|---|---|
| Family ID | F093858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIDLHDPSAVCRSLGYFLDFLVMTVPVISLAIFAWRIAR |
| Number of Associated Samples | 56 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.42 % |
| % of genes near scaffold ends (potentially truncated) | 10.38 % |
| % of genes from short scaffolds (< 2000 bps) | 69.81 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.755 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (29.245 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.660 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 50.00 |
| PF13539 | Peptidase_M15_4 | 6.60 |
| PF04448 | DUF551 | 5.66 |
| PF03837 | RecT | 3.77 |
| PF13589 | HATPase_c_3 | 0.94 |
| PF02498 | Bro-N | 0.94 |
| PF13481 | AAA_25 | 0.94 |
| PF13479 | AAA_24 | 0.94 |
| PF12684 | DUF3799 | 0.94 |
| PF08800 | VirE_N | 0.94 |
| PF00574 | CLP_protease | 0.94 |
| PF00589 | Phage_integrase | 0.94 |
| PF12705 | PDDEXK_1 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 3.77 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG3617 | Prophage antirepressor | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.75 % |
| All Organisms | root | All Organisms | 29.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10055613 | Not Available | 1258 | Open in IMG/M |
| 3300000929|NpDRAFT_10082752 | Not Available | 964 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000306 | All Organisms → cellular organisms → Bacteria | 14640 | Open in IMG/M |
| 3300003413|JGI25922J50271_10003965 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
| 3300004240|Ga0007787_10082816 | Not Available | 1479 | Open in IMG/M |
| 3300005581|Ga0049081_10064854 | All Organisms → cellular organisms → Bacteria → PVC group | 1374 | Open in IMG/M |
| 3300005581|Ga0049081_10094150 | Not Available | 1119 | Open in IMG/M |
| 3300005581|Ga0049081_10119323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300005581|Ga0049081_10124076 | Not Available | 954 | Open in IMG/M |
| 3300005581|Ga0049081_10135091 | Not Available | 908 | Open in IMG/M |
| 3300005581|Ga0049081_10152681 | Not Available | 844 | Open in IMG/M |
| 3300005581|Ga0049081_10216460 | Not Available | 682 | Open in IMG/M |
| 3300005581|Ga0049081_10218086 | Not Available | 679 | Open in IMG/M |
| 3300005581|Ga0049081_10228994 | Not Available | 658 | Open in IMG/M |
| 3300005581|Ga0049081_10230606 | Not Available | 655 | Open in IMG/M |
| 3300005581|Ga0049081_10267033 | Not Available | 596 | Open in IMG/M |
| 3300005581|Ga0049081_10280984 | Not Available | 577 | Open in IMG/M |
| 3300005581|Ga0049081_10319732 | Not Available | 531 | Open in IMG/M |
| 3300005582|Ga0049080_10033425 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300005582|Ga0049080_10062534 | Not Available | 1280 | Open in IMG/M |
| 3300005582|Ga0049080_10185832 | Not Available | 689 | Open in IMG/M |
| 3300005582|Ga0049080_10198325 | Not Available | 664 | Open in IMG/M |
| 3300005582|Ga0049080_10298924 | Not Available | 519 | Open in IMG/M |
| 3300006030|Ga0075470_10031370 | Not Available | 1644 | Open in IMG/M |
| 3300006484|Ga0070744_10053911 | Not Available | 1177 | Open in IMG/M |
| 3300006641|Ga0075471_10063729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2026 | Open in IMG/M |
| 3300006641|Ga0075471_10091853 | Not Available | 1635 | Open in IMG/M |
| 3300006875|Ga0075473_10016820 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300007545|Ga0102873_1268281 | Not Available | 512 | Open in IMG/M |
| 3300007550|Ga0102880_1127282 | Not Available | 668 | Open in IMG/M |
| 3300007551|Ga0102881_1053141 | Not Available | 1133 | Open in IMG/M |
| 3300007551|Ga0102881_1215132 | Not Available | 532 | Open in IMG/M |
| 3300007555|Ga0102817_1030876 | Not Available | 1180 | Open in IMG/M |
| 3300007559|Ga0102828_1007399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2179 | Open in IMG/M |
| 3300007559|Ga0102828_1020547 | Not Available | 1432 | Open in IMG/M |
| 3300007559|Ga0102828_1035602 | Not Available | 1129 | Open in IMG/M |
| 3300007560|Ga0102913_1037038 | Not Available | 1596 | Open in IMG/M |
| 3300007590|Ga0102917_1022495 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 2177 | Open in IMG/M |
| 3300007618|Ga0102896_1084780 | Not Available | 1039 | Open in IMG/M |
| 3300007634|Ga0102901_1056536 | Not Available | 1134 | Open in IMG/M |
| 3300007661|Ga0102866_1140009 | Not Available | 611 | Open in IMG/M |
| 3300008999|Ga0102816_1179172 | Not Available | 660 | Open in IMG/M |
| 3300008999|Ga0102816_1230085 | Not Available | 582 | Open in IMG/M |
| 3300009026|Ga0102829_1012540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2353 | Open in IMG/M |
| 3300009026|Ga0102829_1095159 | Not Available | 926 | Open in IMG/M |
| 3300009158|Ga0114977_10065109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2240 | Open in IMG/M |
| 3300009163|Ga0114970_10005435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9184 | Open in IMG/M |
| 3300009185|Ga0114971_10004507 | All Organisms → cellular organisms → Bacteria | 9416 | Open in IMG/M |
| 3300010309|Ga0102890_1040457 | Not Available | 916 | Open in IMG/M |
| 3300012017|Ga0153801_1040779 | Not Available | 820 | Open in IMG/M |
| 3300013372|Ga0177922_10028060 | Not Available | 690 | Open in IMG/M |
| 3300013372|Ga0177922_11074547 | Not Available | 651 | Open in IMG/M |
| 3300013372|Ga0177922_11186582 | Not Available | 967 | Open in IMG/M |
| 3300020151|Ga0211736_10628059 | Not Available | 730 | Open in IMG/M |
| 3300020161|Ga0211726_10113992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
| 3300020161|Ga0211726_10716115 | Not Available | 1209 | Open in IMG/M |
| 3300020162|Ga0211735_10631144 | Not Available | 1693 | Open in IMG/M |
| 3300020162|Ga0211735_11042160 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300021325|Ga0210301_1017392 | Not Available | 788 | Open in IMG/M |
| 3300021328|Ga0210298_1178313 | Not Available | 1280 | Open in IMG/M |
| 3300023184|Ga0214919_10029246 | All Organisms → cellular organisms → Bacteria | 5807 | Open in IMG/M |
| 3300023184|Ga0214919_10061380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 3479 | Open in IMG/M |
| 3300023184|Ga0214919_10066520 | Not Available | 3291 | Open in IMG/M |
| 3300023184|Ga0214919_10098096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 2508 | Open in IMG/M |
| 3300023184|Ga0214919_10101867 | Not Available | 2442 | Open in IMG/M |
| 3300023184|Ga0214919_10106889 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 2361 | Open in IMG/M |
| 3300023184|Ga0214919_10738729 | Not Available | 549 | Open in IMG/M |
| 3300024343|Ga0244777_10049731 | Not Available | 2679 | Open in IMG/M |
| 3300024346|Ga0244775_10307903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. K5869 | 1312 | Open in IMG/M |
| 3300024346|Ga0244775_10505103 | Not Available | 987 | Open in IMG/M |
| 3300024346|Ga0244775_11213372 | Not Available | 587 | Open in IMG/M |
| 3300024348|Ga0244776_10041528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 3643 | Open in IMG/M |
| 3300024348|Ga0244776_10504844 | Not Available | 780 | Open in IMG/M |
| 3300025732|Ga0208784_1004862 | Not Available | 4941 | Open in IMG/M |
| 3300025872|Ga0208783_10019805 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
| 3300025872|Ga0208783_10358175 | Not Available | 570 | Open in IMG/M |
| 3300027236|Ga0208026_1033020 | Not Available | 733 | Open in IMG/M |
| 3300027263|Ga0208446_1019142 | Not Available | 1221 | Open in IMG/M |
| 3300027304|Ga0208810_1082918 | Not Available | 665 | Open in IMG/M |
| 3300027311|Ga0208812_1061014 | Not Available | 775 | Open in IMG/M |
| 3300027320|Ga0208923_1011672 | Not Available | 1540 | Open in IMG/M |
| 3300027320|Ga0208923_1011738 | All Organisms → cellular organisms → Bacteria → PVC group | 1535 | Open in IMG/M |
| 3300027320|Ga0208923_1042128 | Not Available | 814 | Open in IMG/M |
| 3300027531|Ga0208682_1042966 | Not Available | 1179 | Open in IMG/M |
| 3300027608|Ga0208974_1002252 | Not Available | 7245 | Open in IMG/M |
| 3300027608|Ga0208974_1057706 | Not Available | 1100 | Open in IMG/M |
| 3300027659|Ga0208975_1001221 | All Organisms → cellular organisms → Bacteria | 11167 | Open in IMG/M |
| 3300027659|Ga0208975_1001955 | All Organisms → cellular organisms → Bacteria | 8373 | Open in IMG/M |
| 3300027659|Ga0208975_1012095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 2945 | Open in IMG/M |
| 3300027659|Ga0208975_1083656 | Not Available | 941 | Open in IMG/M |
| 3300027659|Ga0208975_1125993 | Not Available | 728 | Open in IMG/M |
| 3300027659|Ga0208975_1166770 | Not Available | 606 | Open in IMG/M |
| 3300027659|Ga0208975_1208000 | Not Available | 520 | Open in IMG/M |
| 3300027679|Ga0209769_1119042 | Not Available | 847 | Open in IMG/M |
| 3300027736|Ga0209190_1000182 | Not Available | 44466 | Open in IMG/M |
| 3300027746|Ga0209597_1004082 | All Organisms → cellular organisms → Bacteria | 8980 | Open in IMG/M |
| 3300027746|Ga0209597_1076305 | Not Available | 1574 | Open in IMG/M |
| 3300027769|Ga0209770_10000327 | All Organisms → cellular organisms → Bacteria | 26609 | Open in IMG/M |
| 3300027769|Ga0209770_10003411 | All Organisms → cellular organisms → Bacteria | 7758 | Open in IMG/M |
| 3300027797|Ga0209107_10013915 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 4562 | Open in IMG/M |
| 3300027797|Ga0209107_10108505 | Not Available | 1475 | Open in IMG/M |
| 3300027892|Ga0209550_10073326 | Not Available | 2652 | Open in IMG/M |
| 3300033995|Ga0335003_0055199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseibacillus → Roseibacillus ishigakijimensis | 2126 | Open in IMG/M |
| 3300033995|Ga0335003_0186207 | Not Available | 1005 | Open in IMG/M |
| 3300034107|Ga0335037_0531035 | Not Available | 627 | Open in IMG/M |
| 3300034110|Ga0335055_0120781 | Not Available | 1192 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 29.25% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 25.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.66% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.77% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.83% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021328 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R877 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027236 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027263 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027304 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100556133 | 3300000756 | Freshwater And Sediment | MIDLHDPSAVCRSIGFFLDFLTLTVPVISMAFFAWRLAR* |
| NpDRAFT_100827522 | 3300000929 | Freshwater And Marine | MIDLNDPDAVCRSIGYFLDFLTIFVPPVALAFTAWRIAR* |
| JGI25922J50271_1000030619 | 3300003413 | Freshwater Lake | MIDFHDPSAVCRSIGYFLDFLTITVPVISLAIFAWRIAR* |
| JGI25922J50271_100039659 | 3300003413 | Freshwater Lake | MIDLHDPSAVCRSIGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0007787_100828165 | 3300004240 | Freshwater Lake | MIDLHDPQTICRSIGFFLDFLTLTVPVISMAIFAWRLAR* |
| Ga0049081_100648545 | 3300005581 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0049081_100941503 | 3300005581 | Freshwater Lentic | MIDLHDPQNVCRSLGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0049081_101193233 | 3300005581 | Freshwater Lentic | MIDLNDPSAVCRSIGYFLDFLVMFVPVLSLAILGRRIAR* |
| Ga0049081_101240764 | 3300005581 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLTLTVPVLSLALLARRIAR* |
| Ga0049081_101350913 | 3300005581 | Freshwater Lentic | MIDIHDPSAVCRSLGYFLEFLVMFVPPVALAFTAWRIAR* |
| Ga0049081_101526812 | 3300005581 | Freshwater Lentic | MIDIHDPSAVCRSIGYFLDFLTMTVPVISLAIFAWRIAR* |
| Ga0049081_102164602 | 3300005581 | Freshwater Lentic | MIDLTDPSAVCRSLGYFLDFITLTVPVISLALLARRIAR* |
| Ga0049081_102180861 | 3300005581 | Freshwater Lentic | MIDLHDPQTICRSIGFFLDFLTLTVPVISMAFFAWRLAR* |
| Ga0049081_102289944 | 3300005581 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLFITVPVISLVLVARRIAR* |
| Ga0049081_102306063 | 3300005581 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLTLTVPVLSLALVARRIAR* |
| Ga0049081_102670333 | 3300005581 | Freshwater Lentic | EMIDIHDPSAVCRSLGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0049081_102809842 | 3300005581 | Freshwater Lentic | MIDFHDPQNVCRSLGYFLDFLVMTVPILSLSIFAWRIAR* |
| Ga0049081_103197323 | 3300005581 | Freshwater Lentic | MIDLHDPSAVCRSIGYFLDFLIMTVPILSLSIFAWRIAR* |
| Ga0049080_100334253 | 3300005582 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLTLTVPVLSLALLARRIAR* |
| Ga0049080_100625342 | 3300005582 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLTMTVPVLSLALIARRIAR* |
| Ga0049080_101858323 | 3300005582 | Freshwater Lentic | MIDLTDPSAVCRSLGYFLDFLTLTVPVLSLALLARRIAR* |
| Ga0049080_101983253 | 3300005582 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0049080_102989242 | 3300005582 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLFITVPVLSLALLARRIAR* |
| Ga0075470_100313705 | 3300006030 | Aqueous | MIDLHDPTAVCRSLGYFLDFLAITVPVISLALIARRIAR* |
| Ga0070744_100539114 | 3300006484 | Estuarine | MIDLHDPSAVCRSLGFFLDFLVMTVPVLSLAIFAWRIAR* |
| Ga0075471_100637295 | 3300006641 | Aqueous | MIDIHDPTAVCRALGYFLDFLTITVPVISLALIARRIAR* |
| Ga0075471_100918536 | 3300006641 | Aqueous | MIDLHDPQTICRSIGYFLDFLTLTVPVVSMALLAWRIAR* |
| Ga0075473_100168201 | 3300006875 | Aqueous | MIDLHDPQFICRSIGYFLDFLTISVPVISMAIFAWRIAR* |
| Ga0102873_12682812 | 3300007545 | Estuarine | MIDLHDPSAVCRSIGYFLDFLVIFVPILSLSIFAWRIAR* |
| Ga0102880_11272822 | 3300007550 | Estuarine | MIDLHDPFAVCRSIGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102881_10531412 | 3300007551 | Estuarine | MIDLHDPSAVCRSIGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0102881_12151321 | 3300007551 | Estuarine | QRSQPRNREGKMIDLNDPASVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102817_10308763 | 3300007555 | Estuarine | MIDLNDPQTVCRSIGYFLDFLTMTVPVISMAFFAWRLAR* |
| Ga0102828_10073992 | 3300007559 | Estuarine | MIDLHDPQAVCRSIGYFLDFLTMTVPVISMAFFAWRLAR* |
| Ga0102828_10205473 | 3300007559 | Estuarine | MIDLNDPASVCRSLGYFLDFLTLTVPVLSLAIFAWRIAR* |
| Ga0102828_10356022 | 3300007559 | Estuarine | MIDLHDPASVCRSIGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102913_10370383 | 3300007560 | Estuarine | MIDLNDPASVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102917_10224956 | 3300007590 | Estuarine | MIDLHDQQTICRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102896_10847804 | 3300007618 | Estuarine | MIDLHDPSAVCRSIGYFLDFLVIFVPILSLSIFAWR |
| Ga0102901_10565365 | 3300007634 | Estuarine | MIDLHDPFAVCRSIGYFLDFLVIFVPILSLSIFAWRIAR* |
| Ga0102866_11400091 | 3300007661 | Estuarine | RSQPRNREGKMIDLNDPASVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0102816_11791721 | 3300008999 | Estuarine | MIDLHDPASVCRSIGYFLDFLVIFVPPVALALLARRIAR* |
| Ga0102816_12300851 | 3300008999 | Estuarine | KQEGEMIDLNDPASVCRSLGYFLDFLTLTVPVLSLAIFAWRIAR* |
| Ga0102829_10125402 | 3300009026 | Estuarine | MIDLHDPASVCRSIGYFLDFLTMTVPVLSLAIFAWRIAR* |
| Ga0102829_10951592 | 3300009026 | Estuarine | MIDLHDPASVCRSLGYFLDFLVMFVPPVALAIFAWRIAR* |
| Ga0114977_100651095 | 3300009158 | Freshwater Lake | MIDLHDPSAVCRSIGYFLDFLTLTVPVLSLALIARRIAR* |
| Ga0114970_1000543512 | 3300009163 | Freshwater Lake | MIDLNDPAAVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0114971_100045079 | 3300009185 | Freshwater Lake | MIDLHDPSAVCRSLGYFLDFLVMTVPILSLSIFAWRIAR* |
| Ga0102890_10404574 | 3300010309 | Estuarine | MIDLHDPVAVCRSIGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0153801_10407792 | 3300012017 | Freshwater | MIDLNDPSAVCRSLGYFLDFLVMFVPPVALAFTAWRIAR* |
| Ga0177922_100280604 | 3300013372 | Freshwater | MIDLNDPSAVCRSLGYFLEFLVMFVPPVALAFTAWRIAR* |
| Ga0177922_110745472 | 3300013372 | Freshwater | MIDLNDPSAVCRSLGYFLDFLVIFVPPVALAFTAWRIAR* |
| Ga0177922_111865821 | 3300013372 | Freshwater | MIDLHDPQTICRSIGFFLDFLVLTVPVISMAIFAWRLAR* |
| Ga0211736_106280591 | 3300020151 | Freshwater | MIDLTDPSAVCRSLGYFLDFLTMTVPVLSLALLARRIAR |
| Ga0211726_101139924 | 3300020161 | Freshwater | MIDLYDPSAVCRSLGYFLDFLAMTVPVISLALLARRIAR |
| Ga0211726_107161153 | 3300020161 | Freshwater | MIDLNDPSAVCRSLGYFLDFLTMTVPVISLALLARRIAR |
| Ga0211735_106311442 | 3300020162 | Freshwater | MIDLHDPQTICRSIGFFLDFLTLTVPVISMSLLAWRIAR |
| Ga0211735_110421608 | 3300020162 | Freshwater | MIDLHDPQSICRSIGYFLDFLVLTVPVISMAIFAWRLAR |
| Ga0210301_10173922 | 3300021325 | Estuarine | MIDLNDPQTVCRSLSYLLDFLVMTVPVLSLAIFAWRIAR |
| Ga0210298_11783134 | 3300021328 | Estuarine | MIDLNDPSAVCRSIGYFLDFLTMTVPVLSLAIFAWRIAR |
| Ga0214919_1002924610 | 3300023184 | Freshwater | MIDIHDPAAVCRSIGYFLDFLTLTLPVISLALIARRIAR |
| Ga0214919_100613804 | 3300023184 | Freshwater | MIDLHDPAAVCRSIGYFLDFLTITVPVISLAILARRIAR |
| Ga0214919_100665206 | 3300023184 | Freshwater | MIDLHDPSAVCRSLGYFLDFLVITVPVISMAVFAWRLAR |
| Ga0214919_100980966 | 3300023184 | Freshwater | MIDLHDPDAVCRSIGYFLDFLTMTVPVLSLVLIARRIAR |
| Ga0214919_101018672 | 3300023184 | Freshwater | MIDLNDPDAVCRSIGYFLDFLTMTVPVLSLVLIAWRIAR |
| Ga0214919_101068891 | 3300023184 | Freshwater | KGCTEMIDIHDPAAVCRSIGYFLDFLTLTVPVLSLVLIARRIAR |
| Ga0214919_107387292 | 3300023184 | Freshwater | MIDLHDPDAVCRSLGYFLDFLTLTVPVISLVLIARRIAR |
| Ga0244777_100497316 | 3300024343 | Estuarine | MIDLHDPFAVCRSIGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0244775_103079033 | 3300024346 | Estuarine | MIDLHDPQAVCRSIGYFLDFLTMTVPVISMAFFAWRLAR |
| Ga0244775_105051032 | 3300024346 | Estuarine | MIDLNDPASVCRSLGYFLDFLTLTVPVLSLAIFAWRIAR |
| Ga0244775_112133723 | 3300024346 | Estuarine | MIDLHDPASVCRSIGYFLDFLVIFVPPVALAIFAWRIAR |
| Ga0244776_100415284 | 3300024348 | Estuarine | MIDLHDPSAVCRSIGYFLDFLVIFVPILSLSIFAWRIAR |
| Ga0244776_105048442 | 3300024348 | Estuarine | MIDLHDPSAVCRSLGYFLDFLVMFVPVLSLAILARRIAR |
| Ga0208784_100486212 | 3300025732 | Aqueous | MIDLHDPTAVCRSLGYFLDFLAITVPVISLALIARRIAR |
| Ga0208783_100198054 | 3300025872 | Aqueous | MIDLHDPQFICRSIGYFLDFLTISVPVISMAIFAWRIAR |
| Ga0208783_103581751 | 3300025872 | Aqueous | KYFMIDLHDPQTICRSIGYFLDFLTLTVPVVSMALLAWRIAR |
| Ga0208026_10330203 | 3300027236 | Estuarine | MIDLHDPSAVCRSIGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0208446_10191423 | 3300027263 | Estuarine | MIDLHDPFAVCRSIGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0208810_10829183 | 3300027304 | Estuarine | MIDLNDPASVCRSLGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0208812_10610145 | 3300027311 | Estuarine | MIDLHDQQTICRSLGYFLDFLVMFVPPVALAFTAWRI |
| Ga0208923_10116725 | 3300027320 | Estuarine | MIDLHDPSAVCRSIGFFLDFLTLTVPVISMAFFAWRLAR |
| Ga0208923_10117384 | 3300027320 | Estuarine | MIDLHDPASVCRSIGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0208923_10421282 | 3300027320 | Estuarine | MIDLHDPQTICRSIGFFLDFLTLTVPVISMAIFAWRLAR |
| Ga0208682_10429662 | 3300027531 | Estuarine | MIDLHDQQTICRSLGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0208974_10022524 | 3300027608 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLTMTVPVLSLALIARRIAR |
| Ga0208974_10577062 | 3300027608 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0208975_100122113 | 3300027659 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0208975_100195512 | 3300027659 | Freshwater Lentic | MIDLHDPSAVCRSLGYFLDFLTLTVPVLSLALLARRIAR |
| Ga0208975_10120956 | 3300027659 | Freshwater Lentic | MIDIHDPSAVCRSIGYFLDFLTMTVPVISLAIFAWRIAR |
| Ga0208975_10836565 | 3300027659 | Freshwater Lentic | MIDLNDPSAVCRSLGYFLDFLTLTVPVLSLALVARRIAR |
| Ga0208975_11259933 | 3300027659 | Freshwater Lentic | MIDLHDPQNVCRSLGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0208975_11667702 | 3300027659 | Freshwater Lentic | MIDFHDPQNVCRSLGYFLDFLVMTVPILSLSIFAWRIAR |
| Ga0208975_12080003 | 3300027659 | Freshwater Lentic | RNREGQMIDLHDPQNVCRSLGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0209769_11190424 | 3300027679 | Freshwater Lake | MIDLHDPQTICRSIGFFLDFLTLTLPVISMAFFAWRLAR |
| Ga0209190_100018232 | 3300027736 | Freshwater Lake | VDLRPDRRDLKQETLEMIDLNDPAAVCRSLGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0209597_10040829 | 3300027746 | Freshwater Lake | MIDLHDPSAVCRSLGYFLDFLVMTVPILSLSIFAWRIAR |
| Ga0209597_10763054 | 3300027746 | Freshwater Lake | MIDLNDPSEVCRSIGYFLDFLTMTVPVLSLALIARRIAR |
| Ga0209770_1000032730 | 3300027769 | Freshwater Lake | MIDFHDPSAVCRSIGYFLDFLTITVPVISLAIFAWRIAR |
| Ga0209770_100034112 | 3300027769 | Freshwater Lake | MIDLHDPSAVCRSIGYFLDFLVMFVPPVALAFTAWRIAR |
| Ga0209107_1001391510 | 3300027797 | Freshwater And Sediment | MIDLHDPASVCRSLGYFLDFLVIFVPPVALAFTAWRIAR |
| Ga0209107_101085055 | 3300027797 | Freshwater And Sediment | QPRNREGQMIDLHDPQTICRSLGYFLDFLTIFVPPVALAFTAWRIAR |
| Ga0209550_100733263 | 3300027892 | Freshwater Lake | MIDLHDPSAVCRSLGYFLDFLVMTVPVISLAIFAWRIAR |
| Ga0335003_0055199_883_1002 | 3300033995 | Freshwater | MIDLHDPAAVCRSLGYFLDFLTLTVPVLSLALIARRIAR |
| Ga0335003_0186207_377_496 | 3300033995 | Freshwater | MIDLNDPSAVCRSIGYFLDFLVMTVPPVALAFTAWRIAR |
| Ga0335037_0531035_160_279 | 3300034107 | Freshwater | MIDLHDPQNVCRSLGYFLEFLTITVPVISLALIARRIAR |
| Ga0335055_0120781_350_469 | 3300034110 | Freshwater | MIDLHDPQTICRSIGFFLDFLTLTVPVISMAFTAWRIAR |
| ⦗Top⦘ |