


| Basic Information | |
|---|---|
| Family ID | F093799 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | FYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.89 % |
| % of genes near scaffold ends (potentially truncated) | 97.17 % |
| % of genes from short scaffolds (< 2000 bps) | 87.74 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.698 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (20.755 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.170 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.91% β-sheet: 0.00% Coil/Unstructured: 72.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF09723 | Zn-ribbon_8 | 6.60 |
| PF01844 | HNH | 1.89 |
| PF05869 | Dam | 0.94 |
| PF05065 | Phage_capsid | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.30 % |
| Unclassified | root | N/A | 21.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004051|Ga0055492_10110139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 625 | Open in IMG/M |
| 3300005419|Ga0068883_1578671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 501 | Open in IMG/M |
| 3300005525|Ga0068877_10361451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 826 | Open in IMG/M |
| 3300005527|Ga0068876_10073491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2058 | Open in IMG/M |
| 3300005527|Ga0068876_10762183 | Not Available | 513 | Open in IMG/M |
| 3300005528|Ga0068872_10326825 | Not Available | 845 | Open in IMG/M |
| 3300005528|Ga0068872_10741703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 514 | Open in IMG/M |
| 3300005582|Ga0049080_10183107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 695 | Open in IMG/M |
| 3300005613|Ga0074649_1252641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 512 | Open in IMG/M |
| 3300005943|Ga0073926_10032470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 980 | Open in IMG/M |
| 3300006637|Ga0075461_10021001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2158 | Open in IMG/M |
| 3300006641|Ga0075471_10554524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 566 | Open in IMG/M |
| 3300006802|Ga0070749_10061680 | All Organisms → Viruses → Predicted Viral | 2262 | Open in IMG/M |
| 3300006917|Ga0075472_10054780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1896 | Open in IMG/M |
| 3300006919|Ga0070746_10288450 | Not Available | 757 | Open in IMG/M |
| 3300007212|Ga0103958_1023570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1325 | Open in IMG/M |
| 3300007276|Ga0070747_1193878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 718 | Open in IMG/M |
| 3300007363|Ga0075458_10182661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 645 | Open in IMG/M |
| 3300007559|Ga0102828_1207520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 504 | Open in IMG/M |
| 3300008122|Ga0114359_1132869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 883 | Open in IMG/M |
| 3300008266|Ga0114363_1149050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 778 | Open in IMG/M |
| 3300008450|Ga0114880_1076703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1344 | Open in IMG/M |
| 3300008450|Ga0114880_1129024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 939 | Open in IMG/M |
| 3300008450|Ga0114880_1204462 | Not Available | 658 | Open in IMG/M |
| 3300008450|Ga0114880_1265851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 523 | Open in IMG/M |
| 3300010316|Ga0136655_1087678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 946 | Open in IMG/M |
| 3300010316|Ga0136655_1170574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 648 | Open in IMG/M |
| 3300010354|Ga0129333_10448025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1137 | Open in IMG/M |
| 3300010354|Ga0129333_11186867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 634 | Open in IMG/M |
| 3300010368|Ga0129324_10323738 | Not Available | 603 | Open in IMG/M |
| 3300010370|Ga0129336_10414054 | Not Available | 735 | Open in IMG/M |
| 3300010370|Ga0129336_10468508 | Not Available | 682 | Open in IMG/M |
| 3300011381|Ga0102688_1532117 | Not Available | 528 | Open in IMG/M |
| 3300012013|Ga0153805_1025640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1003 | Open in IMG/M |
| 3300012017|Ga0153801_1028403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 990 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_11051648 | Not Available | 512 | Open in IMG/M |
| 3300017700|Ga0181339_1031543 | Not Available | 581 | Open in IMG/M |
| 3300017701|Ga0181364_1049165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 662 | Open in IMG/M |
| 3300017707|Ga0181363_1022106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1241 | Open in IMG/M |
| 3300017747|Ga0181352_1028705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1687 | Open in IMG/M |
| 3300017747|Ga0181352_1087224 | Not Available | 867 | Open in IMG/M |
| 3300017777|Ga0181357_1285236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 565 | Open in IMG/M |
| 3300017788|Ga0169931_10959435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 534 | Open in IMG/M |
| 3300019122|Ga0188839_1030840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 529 | Open in IMG/M |
| 3300019784|Ga0181359_1013729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2955 | Open in IMG/M |
| 3300020161|Ga0211726_10652853 | Not Available | 643 | Open in IMG/M |
| 3300020172|Ga0211729_10135835 | Not Available | 570 | Open in IMG/M |
| 3300020172|Ga0211729_10514136 | Not Available | 558 | Open in IMG/M |
| 3300020179|Ga0194134_10207166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 837 | Open in IMG/M |
| 3300020205|Ga0211731_10744197 | Not Available | 742 | Open in IMG/M |
| 3300020205|Ga0211731_11753329 | Not Available | 637 | Open in IMG/M |
| 3300020532|Ga0208601_1021473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 972 | Open in IMG/M |
| 3300021351|Ga0210365_10261921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 563 | Open in IMG/M |
| 3300022407|Ga0181351_1142890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 870 | Open in IMG/M |
| 3300024480|Ga0255223_1064061 | Not Available | 630 | Open in IMG/M |
| 3300024496|Ga0255151_1047681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 708 | Open in IMG/M |
| 3300024507|Ga0255176_1054161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300024569|Ga0255243_1121161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 638 | Open in IMG/M |
| 3300026478|Ga0255156_1029056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1057 | Open in IMG/M |
| 3300026478|Ga0255156_1083119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 567 | Open in IMG/M |
| 3300026888|Ga0209900_1012561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 656 | Open in IMG/M |
| 3300027126|Ga0255098_1033266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 806 | Open in IMG/M |
| 3300027133|Ga0255070_1005048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2515 | Open in IMG/M |
| 3300027157|Ga0255204_1089540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 535 | Open in IMG/M |
| 3300027486|Ga0255086_1024593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1088 | Open in IMG/M |
| 3300027488|Ga0255084_1009142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2022 | Open in IMG/M |
| 3300027644|Ga0209356_1018854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2347 | Open in IMG/M |
| 3300027697|Ga0209033_1053201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1449 | Open in IMG/M |
| 3300027732|Ga0209442_1245733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 641 | Open in IMG/M |
| 3300027793|Ga0209972_10230205 | Not Available | 845 | Open in IMG/M |
| 3300027816|Ga0209990_10022766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3496 | Open in IMG/M |
| 3300027892|Ga0209550_10344110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 942 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1074410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1644 | Open in IMG/M |
| 3300028091|Ga0255184_1030566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1122 | Open in IMG/M |
| 3300029349|Ga0238435_120951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 521 | Open in IMG/M |
| 3300029930|Ga0119944_1008570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1574 | Open in IMG/M |
| 3300031578|Ga0307376_10858709 | Not Available | 556 | Open in IMG/M |
| 3300031758|Ga0315907_10098666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2505 | Open in IMG/M |
| 3300031758|Ga0315907_11212048 | Not Available | 528 | Open in IMG/M |
| 3300031787|Ga0315900_10478868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 951 | Open in IMG/M |
| 3300031857|Ga0315909_10079558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2896 | Open in IMG/M |
| 3300031857|Ga0315909_10140633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2006 | Open in IMG/M |
| 3300031857|Ga0315909_10596602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 739 | Open in IMG/M |
| 3300031951|Ga0315904_10206137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1925 | Open in IMG/M |
| 3300031951|Ga0315904_10395433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1254 | Open in IMG/M |
| 3300031951|Ga0315904_10566601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 986 | Open in IMG/M |
| 3300031963|Ga0315901_10250338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1498 | Open in IMG/M |
| 3300031963|Ga0315901_10942581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 609 | Open in IMG/M |
| 3300031963|Ga0315901_10958700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 602 | Open in IMG/M |
| 3300031963|Ga0315901_11085821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 551 | Open in IMG/M |
| 3300031963|Ga0315901_11241601 | Not Available | 502 | Open in IMG/M |
| 3300032050|Ga0315906_11035637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 613 | Open in IMG/M |
| 3300032050|Ga0315906_11081243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 594 | Open in IMG/M |
| 3300033557|Ga0316617_102652415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 521 | Open in IMG/M |
| 3300033981|Ga0334982_0537945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 512 | Open in IMG/M |
| 3300033993|Ga0334994_0392886 | Not Available | 673 | Open in IMG/M |
| 3300034012|Ga0334986_0581342 | Not Available | 536 | Open in IMG/M |
| 3300034022|Ga0335005_0402752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 785 | Open in IMG/M |
| 3300034073|Ga0310130_0001509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12535 | Open in IMG/M |
| 3300034101|Ga0335027_0844525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 526 | Open in IMG/M |
| 3300034102|Ga0335029_0683061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 560 | Open in IMG/M |
| 3300034103|Ga0335030_0188185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1445 | Open in IMG/M |
| 3300034109|Ga0335051_0043900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 2403 | Open in IMG/M |
| 3300034120|Ga0335056_0641672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 544 | Open in IMG/M |
| 3300034200|Ga0335065_0304106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1006 | Open in IMG/M |
| 3300034357|Ga0335064_0893815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 536 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 20.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 15.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.21% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 11.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.66% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.94% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.94% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.94% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300005419 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021351 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.637 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300026888 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055492_101101391 | 3300004051 | Natural And Restored Wetlands | PLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP* |
| Ga0068883_15786712 | 3300005419 | Freshwater Lake | LRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP* |
| Ga0068877_103614511 | 3300005525 | Freshwater Lake | KAQVRFYCQPCADEVQNWPDGTFYSLKEQLDDAINDFAGREKLDVELP* |
| Ga0068876_100734917 | 3300005527 | Freshwater Lake | VRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP* |
| Ga0068876_107621831 | 3300005527 | Freshwater Lake | NEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS* |
| Ga0068872_103268251 | 3300005528 | Freshwater Lake | CANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS* |
| Ga0068872_107417031 | 3300005528 | Freshwater Lake | FYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR* |
| Ga0049080_101831072 | 3300005582 | Freshwater Lentic | QVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP* |
| Ga0074649_12526411 | 3300005613 | Saline Water And Sediment | FYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP* |
| Ga0073926_100324701 | 3300005943 | Sand | AQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR* |
| Ga0075461_100210014 | 3300006637 | Aqueous | VRFYCQSCANEAQNWPDGTFWSLKEQLEAAIDDFAGREKLNVQLP* |
| Ga0075471_105545242 | 3300006641 | Aqueous | RMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS* |
| Ga0070749_100616801 | 3300006802 | Aqueous | QNWPDGTFYSLKEQLEDALKTTAKQEKLDVELPR* |
| Ga0075472_100547806 | 3300006917 | Aqueous | EAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP* |
| Ga0070746_102884502 | 3300006919 | Aqueous | QPCADEVQNWPDGTFWTLKEQLEMAIDEFAGREKLNVELP* |
| Ga0103958_10235701 | 3300007212 | Freshwater Lake | PCANDVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELPR* |
| Ga0070747_11938782 | 3300007276 | Aqueous | YCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP* |
| Ga0075458_101826612 | 3300007363 | Aqueous | LRRAQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR* |
| Ga0102828_12075201 | 3300007559 | Estuarine | FYCQPCADDAQNWPDGTFYSLKEQLEDVINDFAGREKLDVELPR* |
| Ga0114359_11328691 | 3300008122 | Freshwater, Plankton | PLRKAQVRFYFQPCADEAQNWPDGTFHSLKEQLEDAINDFAGREKLDVELP* |
| Ga0114363_11490501 | 3300008266 | Freshwater, Plankton | QVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR* |
| Ga0114880_10767034 | 3300008450 | Freshwater Lake | EAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS* |
| Ga0114880_11290243 | 3300008450 | Freshwater Lake | QPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELA* |
| Ga0114880_12044621 | 3300008450 | Freshwater Lake | AQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP* |
| Ga0114880_12658511 | 3300008450 | Freshwater Lake | MQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVE |
| Ga0136655_10876781 | 3300010316 | Freshwater To Marine Saline Gradient | LRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR* |
| Ga0136655_11705742 | 3300010316 | Freshwater To Marine Saline Gradient | LRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELP* |
| Ga0129333_104480254 | 3300010354 | Freshwater To Marine Saline Gradient | QPCAAEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP* |
| Ga0129333_111868671 | 3300010354 | Freshwater To Marine Saline Gradient | MQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREQLDVELS* |
| Ga0129324_103237382 | 3300010368 | Freshwater To Marine Saline Gradient | CADEAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR* |
| Ga0129336_104140542 | 3300010370 | Freshwater To Marine Saline Gradient | EVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP* |
| Ga0129336_104685081 | 3300010370 | Freshwater To Marine Saline Gradient | AQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS* |
| Ga0102688_15321172 | 3300011381 | Freshwater Lake | DEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP* |
| Ga0153805_10256403 | 3300012013 | Surface Ice | YCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLPR* |
| Ga0153801_10284031 | 3300012017 | Freshwater | YCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR* |
| (restricted) Ga0172371_110516482 | 3300013138 | Freshwater | AQNWPDGTFYSLKEQLQDAINDFAGREKLDVELP* |
| Ga0181339_10315432 | 3300017700 | Freshwater Lake | ADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP |
| Ga0181364_10491652 | 3300017701 | Freshwater Lake | QVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR |
| Ga0181363_10221061 | 3300017707 | Freshwater Lake | AQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINNFAGREKLNVELP |
| Ga0181352_10287051 | 3300017747 | Freshwater Lake | PTRRMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0181352_10872241 | 3300017747 | Freshwater Lake | PCANEVQNWADGTFWSLKEQLDFAIKHYAEQEKLNVELA |
| Ga0181357_12852361 | 3300017777 | Freshwater Lake | RALRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR |
| Ga0169931_109594352 | 3300017788 | Freshwater | PCADEAQNWPDGTFYSLKEQLQDAINDFAGREKLDVELP |
| Ga0188839_10308402 | 3300019122 | Freshwater Lake | YCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0181359_10137291 | 3300019784 | Freshwater Lake | QPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0211726_106528532 | 3300020161 | Freshwater | DDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0211729_101358352 | 3300020172 | Freshwater | DDVQNWPDGTFYSLKQQLEDAINDFAGREKLDVQLP |
| Ga0211729_105141362 | 3300020172 | Freshwater | CADDVQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP |
| Ga0194134_102071661 | 3300020179 | Freshwater Lake | VRFYCQPCANEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0211731_107441972 | 3300020205 | Freshwater | CADDVQNWPDGTFYSLKEQLEDAINDFAGREKLNVELS |
| Ga0211731_117533292 | 3300020205 | Freshwater | CADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0208601_10214733 | 3300020532 | Freshwater | AQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0210365_102619212 | 3300021351 | Estuarine | TPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0181351_11428903 | 3300022407 | Freshwater Lake | EECQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255223_10640612 | 3300024480 | Freshwater | CADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255151_10476811 | 3300024496 | Freshwater | RFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0255176_10541611 | 3300024507 | Freshwater | QVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0255243_11211611 | 3300024569 | Freshwater | RFYCQPCADASQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255156_10290561 | 3300026478 | Freshwater | FYCQPCANEVQNWPDGTFWSLKEQLDYAIEQFAGSEKLNVELP |
| Ga0255156_10831192 | 3300026478 | Freshwater | RRMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0209900_10125611 | 3300026888 | Groundwater Sand | RFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255098_10332662 | 3300027126 | Freshwater | KAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255070_10050486 | 3300027133 | Freshwater | RKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0255204_10895402 | 3300027157 | Freshwater | PLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP |
| Ga0255086_10245931 | 3300027486 | Freshwater | VRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR |
| Ga0255084_10091421 | 3300027488 | Freshwater | VRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0209356_10188548 | 3300027644 | Freshwater Lake | VRFYCQPCADEVQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP |
| Ga0209033_10532015 | 3300027697 | Freshwater Lake | VRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR |
| Ga0209442_12457332 | 3300027732 | Freshwater Lake | KAQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLP |
| Ga0209972_102302051 | 3300027793 | Freshwater Lake | PCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS |
| Ga0209990_1002276610 | 3300027816 | Freshwater Lake | NEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS |
| Ga0209550_103441101 | 3300027892 | Freshwater Lake | DAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| (restricted) Ga0247834_10744101 | 3300027977 | Freshwater | CADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0255184_10305664 | 3300028091 | Freshwater | ETPTRRMQVRFYCQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0238435_1209511 | 3300029349 | Freshwater | FYCQSCANEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP |
| Ga0119944_10085701 | 3300029930 | Aquatic | RFYCQPCANKAQNWPDGTFWSLKEQLEYAIDDFAGREKLNVELS |
| Ga0307376_108587091 | 3300031578 | Soil | PCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0315907_100986661 | 3300031758 | Freshwater | AQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP |
| Ga0315907_112120482 | 3300031758 | Freshwater | ADEVQNWPDGTFWSLKEQLEMAIDEFAGREKLNVELP |
| Ga0315900_104788683 | 3300031787 | Freshwater | CANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS |
| Ga0315909_100795581 | 3300031857 | Freshwater | CQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0315909_101406331 | 3300031857 | Freshwater | EAQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP |
| Ga0315909_105966022 | 3300031857 | Freshwater | PLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREQLDVELPR |
| Ga0315904_102061375 | 3300031951 | Freshwater | QVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0315904_103954331 | 3300031951 | Freshwater | RFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELP |
| Ga0315904_105666011 | 3300031951 | Freshwater | RRGQVRFYCQPCANEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP |
| Ga0315901_102503381 | 3300031963 | Freshwater | AQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP |
| Ga0315901_109425812 | 3300031963 | Freshwater | AQVRFYCQPCADDVQNWPDGTFYSLKEQLEDAINDFAGREKLNVELP |
| Ga0315901_109587001 | 3300031963 | Freshwater | CQPCANEAQNWPDGTFWSLKEQLEAAIDDFAGREQLDVKLS |
| Ga0315901_110858211 | 3300031963 | Freshwater | AQVRFYCQPCADDAQNWPDGTFYSLKEQLQDAINDFAGREKLDVQLP |
| Ga0315901_112416011 | 3300031963 | Freshwater | CANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0315906_110356371 | 3300032050 | Freshwater | QSETPLRRAQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0315906_110812431 | 3300032050 | Freshwater | VWKVQSETPLRRAQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0316617_1026524152 | 3300033557 | Soil | WKVQSETPLRRAQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0334982_0537945_362_511 | 3300033981 | Freshwater | RAQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0334994_0392886_558_671 | 3300033993 | Freshwater | NEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELPR |
| Ga0334986_0581342_421_534 | 3300034012 | Freshwater | DDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0335005_0402752_663_785 | 3300034022 | Freshwater | QPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVQLP |
| Ga0310130_0001509_610_762 | 3300034073 | Fracking Water | MRRGQVRFYCQPCANEAQNWPDGTFWSLKEQLTYAIDQFAGREKLDVELP |
| Ga0335027_0844525_1_135 | 3300034101 | Freshwater | MFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELP |
| Ga0335029_0683061_10_153 | 3300034102 | Freshwater | MQVRFYCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS |
| Ga0335030_0188185_1317_1445 | 3300034103 | Freshwater | YCQPCANEAQNWPDGTFWSLKEQLEYAIDEFAGREKLNVELS |
| Ga0335051_0043900_1_147 | 3300034109 | Freshwater | AQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELPR |
| Ga0335056_0641672_419_544 | 3300034120 | Freshwater | QPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLDVELPR |
| Ga0335065_0304106_2_163 | 3300034200 | Freshwater | TPLRKAQVRFYCQPCADDAQNWPDGTFYSLKEQLEDAINQFAGREKLNVELPR |
| Ga0335064_0893815_383_535 | 3300034357 | Freshwater | RKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAISDFAGREKLDVELPR |
| ⦗Top⦘ |