


| Basic Information | |
|---|---|
| Family ID | F093789 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 83.96 % |
| % of genes from short scaffolds (< 2000 bps) | 91.51 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.774 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.189 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.396 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.396 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.71% Coil/Unstructured: 68.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 6.60 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.89 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.89 |
| PF08291 | Peptidase_M15_3 | 0.94 |
| PF01327 | Pep_deformylase | 0.94 |
| PF01583 | APS_kinase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.77 % |
| All Organisms | root | All Organisms | 46.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10038054 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10080383 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300001460|JGI24003J15210_10086763 | Not Available | 930 | Open in IMG/M |
| 3300001460|JGI24003J15210_10164956 | Not Available | 552 | Open in IMG/M |
| 3300001472|JGI24004J15324_10147187 | Not Available | 548 | Open in IMG/M |
| 3300002231|KVRMV2_101670245 | Not Available | 637 | Open in IMG/M |
| 3300002482|JGI25127J35165_1029265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1273 | Open in IMG/M |
| 3300002488|JGI25128J35275_1047694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 940 | Open in IMG/M |
| 3300005078|Ga0070770_10147451 | Not Available | 684 | Open in IMG/M |
| 3300006025|Ga0075474_10163689 | Not Available | 694 | Open in IMG/M |
| 3300006026|Ga0075478_10165805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 684 | Open in IMG/M |
| 3300006027|Ga0075462_10049369 | Not Available | 1338 | Open in IMG/M |
| 3300006029|Ga0075466_1096076 | Not Available | 809 | Open in IMG/M |
| 3300006637|Ga0075461_10154349 | Not Available | 702 | Open in IMG/M |
| 3300006637|Ga0075461_10167214 | Not Available | 668 | Open in IMG/M |
| 3300006735|Ga0098038_1212185 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 622 | Open in IMG/M |
| 3300006737|Ga0098037_1092156 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300006737|Ga0098037_1212640 | Not Available | 630 | Open in IMG/M |
| 3300006749|Ga0098042_1148958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 574 | Open in IMG/M |
| 3300006789|Ga0098054_1170630 | Not Available | 799 | Open in IMG/M |
| 3300006789|Ga0098054_1237797 | Not Available | 659 | Open in IMG/M |
| 3300006810|Ga0070754_10043926 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300006916|Ga0070750_10489007 | Not Available | 505 | Open in IMG/M |
| 3300006921|Ga0098060_1007670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3622 | Open in IMG/M |
| 3300006921|Ga0098060_1059081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1122 | Open in IMG/M |
| 3300006921|Ga0098060_1148657 | Not Available | 650 | Open in IMG/M |
| 3300006924|Ga0098051_1172600 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 568 | Open in IMG/M |
| 3300006925|Ga0098050_1144680 | Not Available | 599 | Open in IMG/M |
| 3300006928|Ga0098041_1180014 | Not Available | 678 | Open in IMG/M |
| 3300006928|Ga0098041_1183990 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300007229|Ga0075468_10009692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3801 | Open in IMG/M |
| 3300007229|Ga0075468_10035791 | Not Available | 1750 | Open in IMG/M |
| 3300007231|Ga0075469_10058493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1139 | Open in IMG/M |
| 3300007276|Ga0070747_1021140 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300007539|Ga0099849_1119845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1036 | Open in IMG/M |
| 3300007540|Ga0099847_1182933 | Not Available | 615 | Open in IMG/M |
| 3300007541|Ga0099848_1129874 | Not Available | 946 | Open in IMG/M |
| 3300007960|Ga0099850_1051999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1746 | Open in IMG/M |
| 3300007963|Ga0110931_1187906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 618 | Open in IMG/M |
| 3300008220|Ga0114910_1112031 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009414|Ga0114909_1202145 | Not Available | 504 | Open in IMG/M |
| 3300009433|Ga0115545_1123977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
| 3300009438|Ga0115559_1189802 | Not Available | 746 | Open in IMG/M |
| 3300009443|Ga0115557_1028574 | Not Available | 2692 | Open in IMG/M |
| 3300009443|Ga0115557_1117771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1102 | Open in IMG/M |
| 3300009481|Ga0114932_10926242 | Not Available | 501 | Open in IMG/M |
| 3300009505|Ga0115564_10207946 | Not Available | 1016 | Open in IMG/M |
| 3300009507|Ga0115572_10807224 | Not Available | 503 | Open in IMG/M |
| 3300009603|Ga0114911_1102432 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 834 | Open in IMG/M |
| 3300009603|Ga0114911_1152056 | Not Available | 649 | Open in IMG/M |
| 3300009604|Ga0114901_1093965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300009605|Ga0114906_1202014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300009790|Ga0115012_11293293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 617 | Open in IMG/M |
| 3300010151|Ga0098061_1265112 | Not Available | 596 | Open in IMG/M |
| 3300010153|Ga0098059_1194921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 790 | Open in IMG/M |
| 3300010153|Ga0098059_1375313 | Not Available | 538 | Open in IMG/M |
| 3300011258|Ga0151677_1005909 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012953|Ga0163179_10508629 | All Organisms → Viruses → environmental samples → uncultured virus | 997 | Open in IMG/M |
| 3300017706|Ga0181377_1082349 | Not Available | 571 | Open in IMG/M |
| 3300017714|Ga0181412_1132118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 569 | Open in IMG/M |
| 3300017720|Ga0181383_1022498 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300017726|Ga0181381_1136632 | Not Available | 510 | Open in IMG/M |
| 3300017732|Ga0181415_1155168 | Not Available | 511 | Open in IMG/M |
| 3300017737|Ga0187218_1128367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 603 | Open in IMG/M |
| 3300017739|Ga0181433_1098755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300017750|Ga0181405_1046916 | Not Available | 1145 | Open in IMG/M |
| 3300017755|Ga0181411_1171142 | Not Available | 619 | Open in IMG/M |
| 3300017758|Ga0181409_1009212 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300017760|Ga0181408_1019614 | Not Available | 1871 | Open in IMG/M |
| 3300017760|Ga0181408_1057631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300017765|Ga0181413_1024197 | All Organisms → Viruses → Predicted Viral | 1904 | Open in IMG/M |
| 3300017765|Ga0181413_1077431 | Not Available | 1018 | Open in IMG/M |
| 3300017767|Ga0181406_1014397 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300017770|Ga0187217_1116622 | Not Available | 903 | Open in IMG/M |
| 3300017781|Ga0181423_1294674 | Not Available | 599 | Open in IMG/M |
| 3300017782|Ga0181380_1043140 | Not Available | 1629 | Open in IMG/M |
| 3300017782|Ga0181380_1191364 | Not Available | 688 | Open in IMG/M |
| 3300020595|Ga0206126_10525721 | Not Available | 506 | Open in IMG/M |
| 3300021365|Ga0206123_10417525 | Not Available | 549 | Open in IMG/M |
| 3300022061|Ga0212023_1010868 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300022061|Ga0212023_1040567 | Not Available | 647 | Open in IMG/M |
| 3300022071|Ga0212028_1052300 | Not Available | 763 | Open in IMG/M |
| 3300022072|Ga0196889_1011784 | All Organisms → Viruses | 1904 | Open in IMG/M |
| 3300022074|Ga0224906_1082482 | Not Available | 972 | Open in IMG/M |
| 3300025086|Ga0208157_1143508 | Not Available | 532 | Open in IMG/M |
| 3300025102|Ga0208666_1147698 | Not Available | 528 | Open in IMG/M |
| 3300025110|Ga0208158_1130729 | Not Available | 578 | Open in IMG/M |
| 3300025120|Ga0209535_1033810 | All Organisms → Viruses | 2374 | Open in IMG/M |
| 3300025120|Ga0209535_1065703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300025128|Ga0208919_1076272 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300025137|Ga0209336_10066342 | Not Available | 1080 | Open in IMG/M |
| 3300025137|Ga0209336_10179102 | Not Available | 537 | Open in IMG/M |
| 3300025274|Ga0208183_1057033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300025301|Ga0208450_1090079 | All Organisms → Viruses | 684 | Open in IMG/M |
| 3300025508|Ga0208148_1066246 | Not Available | 850 | Open in IMG/M |
| 3300025652|Ga0208134_1030172 | All Organisms → Viruses | 1918 | Open in IMG/M |
| 3300025674|Ga0208162_1075974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1050 | Open in IMG/M |
| 3300025685|Ga0209095_1136479 | Not Available | 729 | Open in IMG/M |
| 3300025690|Ga0209505_1098585 | Not Available | 838 | Open in IMG/M |
| 3300025897|Ga0209425_10123716 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300029787|Ga0183757_1036909 | All Organisms → Viruses | 961 | Open in IMG/M |
| 3300032047|Ga0315330_10661789 | Not Available | 613 | Open in IMG/M |
| 3300032047|Ga0315330_10680400 | Not Available | 602 | Open in IMG/M |
| 3300032073|Ga0315315_10943460 | Not Available | 777 | Open in IMG/M |
| 3300032255|Ga0316209_1071406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1010 | Open in IMG/M |
| 3300034374|Ga0348335_135931 | Not Available | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.55% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.55% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.83% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.89% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.94% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.94% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.94% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.94% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005078 | Microbial Community from Halfdan Field MHBA5 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032255 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100380548 | 3300000101 | Marine | NLMKAQGRTNLANGISLDVSDDRKVATWSLLGCEYVHGKQSG* |
| DelMOSum2011_100803835 | 3300000115 | Marine | QGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| JGI24003J15210_100867631 | 3300001460 | Marine | ELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| JGI24003J15210_101649561 | 3300001460 | Marine | MMKAVIFMAASVNKIELKAQGRPNFADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| JGI24004J15324_101471871 | 3300001472 | Marine | MMKAVIFMAASVNKIELKAQGRPNFADGISLYVSDDRKVATWSLAGCEYVHGKQ |
| KVRMV2_1016702451 | 3300002231 | Marine Sediment | VYKIELKAQGRPNLANGISLYVSDDRKVATWSLLSCKYVHGKQLG* |
| JGI25127J35165_10292656 | 3300002482 | Marine | LKAQGRPNLANGISLYVSDDRKVATWSLLGCEYVHGKQSG* |
| JGI25128J35275_10476945 | 3300002488 | Marine | VYKIELKAQGRPNLANGISLYVSDDRKVATWSLLDCKYVHGKQSG* |
| Ga0070770_101474513 | 3300005078 | Water | MEVVTSLVVYKIELKAQGRPNLPMAFPCTLAMIRKVATWSLAGCEYVHGKQ |
| Ga0075474_101636893 | 3300006025 | Aqueous | MMAAVIFTAASVNELKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG* |
| Ga0075478_101658052 | 3300006026 | Aqueous | LKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0075462_100493696 | 3300006027 | Aqueous | MVVVTFTVVYKIELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0075466_10960762 | 3300006029 | Aqueous | KAQGRTNLANGISLDVSDDRKVATWSLLGCEYVHGKQSG* |
| Ga0075461_101543492 | 3300006637 | Aqueous | MAAVIFTAASVKELKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG* |
| Ga0075461_101672141 | 3300006637 | Aqueous | MKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQ |
| Ga0098038_12121851 | 3300006735 | Marine | RPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0098037_10921564 | 3300006737 | Marine | MAVYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEY |
| Ga0098037_12126401 | 3300006737 | Marine | GRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0098042_11489584 | 3300006749 | Marine | LKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQ |
| Ga0098054_11706301 | 3300006789 | Marine | VRPTGSHTELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQL |
| Ga0098054_12377971 | 3300006789 | Marine | VVVCKVVFVNKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0070754_100439267 | 3300006810 | Aqueous | KAQGRTNLANGISLDVSDDRKVATWSLLCCEYVHGKQQG* |
| Ga0070750_104890073 | 3300006916 | Aqueous | MAVYKIELKAQGRPNLANGISLYVSDDRKVATWSLLCCEY |
| Ga0098060_10076701 | 3300006921 | Marine | LKAQGRPNLANGISLYVSDDREVATWSLAGCEYVHGKQLV* |
| Ga0098060_10590812 | 3300006921 | Marine | MMEAVIFMAASVNRIELKAQGRPNLADGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0098060_11486571 | 3300006921 | Marine | MEVVTSMVACVNKMKAQGRPNLADGISLYVSDDREVATWSLAGCEYVDGKQPV* |
| Ga0098051_11726003 | 3300006924 | Marine | PNLANGISLYVSDDRKVATWSLLDCKYVHGKQSG* |
| Ga0098050_11446803 | 3300006925 | Marine | LKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHG |
| Ga0098041_11800142 | 3300006928 | Marine | VVFVNKMKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVDGKQLV* |
| Ga0098041_11839901 | 3300006928 | Marine | LKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQ |
| Ga0075468_100096929 | 3300007229 | Aqueous | MMEAVIFMAASVNRIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0075468_100357916 | 3300007229 | Aqueous | LKAQGRTNLANGISLDVSDDRKVATWSLLCCEYVHGKQQG* |
| Ga0075469_100584933 | 3300007231 | Aqueous | LKAQGRPNLADGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0070747_10211404 | 3300007276 | Aqueous | MMAVVTFTVVYKIELKAQGRPNLANGISLYVSDDRKVATWSLLSCEYVHGKQLG* |
| Ga0099849_11198453 | 3300007539 | Aqueous | RIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0099847_11829331 | 3300007540 | Aqueous | LKAQGRPNLANGISLYVSDDRKVATWSLLSCEYVHGKQLG* |
| Ga0099848_11298742 | 3300007541 | Aqueous | MMAAVIFMAASVNRIELKAQGRPNLANGISLYVSDDRKVATWSLAGC* |
| Ga0099850_10519994 | 3300007960 | Aqueous | MEAVIFMAASVNRIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0110931_11879062 | 3300007963 | Marine | MMAAVIFMAASVNRIELKAQWRPNLADGISLYVSDDRKVATWSLAGYEYV |
| Ga0114910_11120313 | 3300008220 | Deep Ocean | VVYKIELKAQGRPNLADGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0114909_12021451 | 3300009414 | Deep Ocean | MKAQGRPNLANGISLYVSDNRKVATWSLAGCEYVHGKQLV |
| Ga0115545_11239774 | 3300009433 | Pelagic Marine | TFTVVYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0115559_11898021 | 3300009438 | Pelagic Marine | LKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG* |
| Ga0115557_10285741 | 3300009443 | Pelagic Marine | TKLKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG* |
| Ga0115557_11177715 | 3300009443 | Pelagic Marine | VYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0114932_109262422 | 3300009481 | Deep Subsurface | VVYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0115564_102079461 | 3300009505 | Pelagic Marine | MEVDSFMAVYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0115572_108072241 | 3300009507 | Pelagic Marine | LKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0114911_11024324 | 3300009603 | Deep Ocean | KAQGRPNLANGISLYVSDDRKVATWSLLGCEYVHGKQLG* |
| Ga0114911_11520561 | 3300009603 | Deep Ocean | KAQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQLV* |
| Ga0114901_10939651 | 3300009604 | Deep Ocean | IELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0114906_12020143 | 3300009605 | Deep Ocean | QGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0115012_112932931 | 3300009790 | Marine | MEVVTSMVACVNKIELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV* |
| Ga0098061_12651121 | 3300010151 | Marine | KAQGRPNLADGISLYVSDDRKVATWSLTGCEYVHGKQLV* |
| Ga0098059_11949213 | 3300010153 | Marine | MMEAVIFMAASVNRIELKAQGRPNLADGISLYVSDDRKVATWSLAGCKYVHGK |
| Ga0098059_13753131 | 3300010153 | Marine | LVVFVNKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQ |
| Ga0151677_10059091 | 3300011258 | Marine | KAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV* |
| Ga0163179_105086295 | 3300012953 | Seawater | KAQGRPNLANGISLYVSDDRKVATWSLLNCEYVHGKQLG* |
| Ga0181377_10823491 | 3300017706 | Marine | KAQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQLV |
| Ga0181412_11321183 | 3300017714 | Seawater | MKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVH |
| Ga0181383_10224981 | 3300017720 | Seawater | NLKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQLV |
| Ga0181381_11366322 | 3300017726 | Seawater | LKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181415_11551681 | 3300017732 | Seawater | ILLWLYTKLKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVNGKQLV |
| Ga0187218_11283671 | 3300017737 | Seawater | LKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQ |
| Ga0181433_10987551 | 3300017739 | Seawater | IELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQPV |
| Ga0181405_10469161 | 3300017750 | Seawater | RPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181411_11711421 | 3300017755 | Seawater | KIELKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRS |
| Ga0181409_10092121 | 3300017758 | Seawater | AQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181408_10196147 | 3300017760 | Seawater | LIKNKIEKAQGRPNLADGISLYVSDDRKVATWRLLCCQYV |
| Ga0181408_10576311 | 3300017760 | Seawater | QGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181413_10241971 | 3300017765 | Seawater | LKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG |
| Ga0181413_10774313 | 3300017765 | Seawater | KAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHRKQLV |
| Ga0181406_10143971 | 3300017767 | Seawater | NLMKAQGRPNLANGISLYVSDDRKVATWSLLDCEYVHGKQSG |
| Ga0187217_11166223 | 3300017770 | Seawater | KAVIFMAASVNKIELKAQGRPNFADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181423_12946741 | 3300017781 | Seawater | AQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0181380_10431401 | 3300017782 | Seawater | LKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLVLYDLI |
| Ga0181380_11913641 | 3300017782 | Seawater | MAVYKIELKAQGRPNFADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0206126_105257212 | 3300020595 | Seawater | MKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGK |
| Ga0206123_104175251 | 3300021365 | Seawater | AQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG |
| Ga0212023_10108685 | 3300022061 | Aqueous | IELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0212023_10405672 | 3300022061 | Aqueous | MMEAVIFMAASVNRIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV |
| Ga0212028_10523001 | 3300022071 | Aqueous | MKAQGRTNLANGISLDVSDDRKVATWSLLCCEYVHGKQ |
| Ga0196889_10117848 | 3300022072 | Aqueous | KAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0224906_10824824 | 3300022074 | Seawater | AQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQLV |
| Ga0208157_11435082 | 3300025086 | Marine | ELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0208666_11476982 | 3300025102 | Marine | CRVRPTGSHTELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV |
| Ga0208158_11307292 | 3300025110 | Marine | KAQGRPNLANGISLYVSDDRKVATWSLAGCEYVDGKQPV |
| Ga0209535_10338103 | 3300025120 | Marine | MMKAVIFMAASVNKIELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0209535_10657033 | 3300025120 | Marine | MKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0208919_10762721 | 3300025128 | Marine | QGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0209336_100663421 | 3300025137 | Marine | KIELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0209336_101791023 | 3300025137 | Marine | MMKAVIFMAASVNKIELKAQGRPNLADGISLYVSDDRKVATWSLAG |
| Ga0208183_10570331 | 3300025274 | Deep Ocean | VYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0208450_10900791 | 3300025301 | Deep Ocean | MVVVTFTVVYKIELKAQGRPNLANGISLDVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0208148_10662461 | 3300025508 | Aqueous | LKAQGRTYLADGISLDVSDDRKVATWSLLCCEYVHGKQRGSYEL |
| Ga0208134_10301721 | 3300025652 | Aqueous | VVYKIKLKAQGRPNLANGISLYVSDDRKVATWSLLSCEYVHGKQLG |
| Ga0208162_10759743 | 3300025674 | Aqueous | RIELKAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLV |
| Ga0209095_11364794 | 3300025685 | Pelagic Marine | YKIELKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQSV |
| Ga0209505_10985854 | 3300025690 | Pelagic Marine | FMAVYKIELKAQGRPNLANGISLYVSDDRKVATWSLLCCKYVHGKQQG |
| Ga0209425_101237161 | 3300025897 | Pelagic Marine | KAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQRG |
| Ga0183757_10369095 | 3300029787 | Marine | KIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0315330_106617891 | 3300032047 | Seawater | TLMMKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| Ga0315330_106804003 | 3300032047 | Seawater | MMKAQGRPNLADGISLYVSDDRKVATWSLAGCEYVHGKQLVLY |
| Ga0315315_109434601 | 3300032073 | Seawater | SHTELKAQGRPNLANGISLYVSDDRKVATWSLLCCEYVHGKQ |
| Ga0316209_10714061 | 3300032255 | Microbial Mat | KAQGRPNLANGISLYVSDDRKVATWSLAGCKYVHGKQLVLYD |
| Ga0348335_135931_67_228 | 3300034374 | Aqueous | MVVVTFTVVYKIELKAQGRPNLANGISLYVSDDRKVATWSLAGCEYVHGKQLV |
| ⦗Top⦘ |