


| Basic Information | |
|---|---|
| Family ID | F093759 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MFKVTFYVYSKVLNKEFRNVEIHKSMDDARLRALALMWQIESVEEV |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.79 % |
| % of genes near scaffold ends (potentially truncated) | 12.26 % |
| % of genes from short scaffolds (< 2000 bps) | 67.92 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.72 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.566 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.868 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.623 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.453 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.51% β-sheet: 33.78% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| d.58.12.1: eEF-1beta-like | d2b7cb_ | 2b7c | 0.75 |
| d.58.18.4: ACT-like | d2bj7a2 | 2bj7 | 0.72 |
| d.58.4.0: Dimeric alpha+beta barrel | d4w7ka_ | 4w7k | 0.71 |
| d.58.4.2: Dimeric alpha+beta barrel | d2cfxa2 | 2cfx | 0.7 |
| d.58.10.0: Acylphosphatase/BLUF domain-like | d3br8a_ | 3br8 | 0.7 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13479 | AAA_24 | 13.21 |
| PF14549 | P22_Cro | 6.60 |
| PF14090 | HTH_39 | 2.83 |
| PF04404 | ERF | 2.83 |
| PF05037 | DUF669 | 2.83 |
| PF01555 | N6_N4_Mtase | 1.89 |
| PF07484 | Collar | 1.89 |
| PF05866 | RusA | 1.89 |
| PF01381 | HTH_3 | 1.89 |
| PF09250 | Prim-Pol | 1.89 |
| PF06378 | DUF1071 | 1.89 |
| PF08960 | STIV_B116-like | 0.94 |
| PF16510 | P22_portal | 0.94 |
| PF07120 | DUF1376 | 0.94 |
| PF01326 | PPDK_N | 0.94 |
| PF00535 | Glycos_transf_2 | 0.94 |
| PF13604 | AAA_30 | 0.94 |
| PF07750 | GcrA | 0.94 |
| PF11351 | GTA_holin_3TM | 0.94 |
| PF00436 | SSB | 0.94 |
| PF01807 | zf-CHC2 | 0.94 |
| PF03796 | DnaB_C | 0.94 |
| PF12844 | HTH_19 | 0.94 |
| PF05772 | NinB | 0.94 |
| PF16786 | RecA_dep_nuc | 0.94 |
| PF09588 | YqaJ | 0.94 |
| PF04466 | Terminase_3 | 0.94 |
| PF13443 | HTH_26 | 0.94 |
| PF11651 | P22_CoatProtein | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.89 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.89 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.89 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.94 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.94 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.94 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.94 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.94 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.94 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.94 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.94 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.43 % |
| Unclassified | root | N/A | 40.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000947|BBAY92_10005775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3228 | Open in IMG/M |
| 3300001605|Draft_10556426 | Not Available | 595 | Open in IMG/M |
| 3300002180|JGI24724J26744_10003732 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 9807 | Open in IMG/M |
| 3300002200|metazooDRAFT_1280159 | Not Available | 1081 | Open in IMG/M |
| 3300002834|JGI24696J40584_12923462 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300003277|JGI25908J49247_10142464 | Not Available | 561 | Open in IMG/M |
| 3300003430|JGI25921J50272_10000552 | All Organisms → cellular organisms → Bacteria | 12196 | Open in IMG/M |
| 3300003431|JGI25913J50563_1005823 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300004460|Ga0066222_1140325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1886 | Open in IMG/M |
| 3300004901|Ga0068517_1002448 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
| 3300005581|Ga0049081_10006502 | Not Available | 4421 | Open in IMG/M |
| 3300005581|Ga0049081_10149618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300005805|Ga0079957_1035087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3261 | Open in IMG/M |
| 3300006037|Ga0075465_10079323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300006045|Ga0082212_10120485 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
| 3300006641|Ga0075471_10172191 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300006802|Ga0070749_10002633 | All Organisms → cellular organisms → Bacteria | 12022 | Open in IMG/M |
| 3300006802|Ga0070749_10002891 | Not Available | 11505 | Open in IMG/M |
| 3300006802|Ga0070749_10020077 | All Organisms → cellular organisms → Bacteria | 4238 | Open in IMG/M |
| 3300006802|Ga0070749_10064065 | Not Available | 2214 | Open in IMG/M |
| 3300006802|Ga0070749_10159420 | Not Available | 1308 | Open in IMG/M |
| 3300006802|Ga0070749_10170812 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300006802|Ga0070749_10369382 | Not Available | 795 | Open in IMG/M |
| 3300006802|Ga0070749_10468597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300006803|Ga0075467_10098729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1739 | Open in IMG/M |
| 3300006875|Ga0075473_10063243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Salicola phage CGphi29 | 1442 | Open in IMG/M |
| 3300007169|Ga0102976_1089741 | Not Available | 1505 | Open in IMG/M |
| 3300007538|Ga0099851_1048936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
| 3300007541|Ga0099848_1037192 | Not Available | 2006 | Open in IMG/M |
| 3300008110|Ga0114343_1045600 | All Organisms → Viruses → Predicted Viral | 1724 | Open in IMG/M |
| 3300008266|Ga0114363_1075672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2075 | Open in IMG/M |
| 3300008266|Ga0114363_1214938 | Not Available | 576 | Open in IMG/M |
| 3300008448|Ga0114876_1066911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
| 3300008448|Ga0114876_1224069 | Not Available | 611 | Open in IMG/M |
| 3300009068|Ga0114973_10084621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1818 | Open in IMG/M |
| 3300009075|Ga0105090_10270393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1044 | Open in IMG/M |
| 3300009155|Ga0114968_10286769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300009159|Ga0114978_10070607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2353 | Open in IMG/M |
| 3300009159|Ga0114978_10395924 | Not Available | 828 | Open in IMG/M |
| 3300009159|Ga0114978_10458111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300009164|Ga0114975_10267509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300009168|Ga0105104_10048062 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
| 3300009180|Ga0114979_10064276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2290 | Open in IMG/M |
| 3300010233|Ga0136235_1001502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10464 | Open in IMG/M |
| 3300010354|Ga0129333_10125851 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300010354|Ga0129333_11246233 | Not Available | 616 | Open in IMG/M |
| 3300010370|Ga0129336_10082291 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300010413|Ga0136851_10438199 | Not Available | 1309 | Open in IMG/M |
| 3300010429|Ga0116241_10250908 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
| 3300011437|Ga0137429_1180689 | Not Available | 660 | Open in IMG/M |
| 3300012205|Ga0137362_11700402 | Not Available | 518 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10687072 | Not Available | 635 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10220955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1272 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10743851 | Not Available | 575 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10855113 | Not Available | 560 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10173439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
| 3300017716|Ga0181350_1031859 | Not Available | 1450 | Open in IMG/M |
| 3300017754|Ga0181344_1018169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2195 | Open in IMG/M |
| 3300017780|Ga0181346_1002375 | Not Available | 8383 | Open in IMG/M |
| 3300017788|Ga0169931_10743927 | Not Available | 638 | Open in IMG/M |
| 3300017963|Ga0180437_10825602 | All Organisms → Viruses | 668 | Open in IMG/M |
| 3300020048|Ga0207193_1007503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16271 | Open in IMG/M |
| 3300020048|Ga0207193_1363118 | All Organisms → Viruses | 983 | Open in IMG/M |
| 3300020151|Ga0211736_10715016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3565 | Open in IMG/M |
| 3300020167|Ga0194035_1083100 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1058 | Open in IMG/M |
| 3300020176|Ga0181556_1232859 | Not Available | 675 | Open in IMG/M |
| 3300020205|Ga0211731_10289149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 560 | Open in IMG/M |
| 3300021108|Ga0214162_1072477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300022179|Ga0181353_1064806 | Not Available | 941 | Open in IMG/M |
| 3300022198|Ga0196905_1075757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300022217|Ga0224514_10334728 | Not Available | 556 | Open in IMG/M |
| 3300023174|Ga0214921_10002018 | Not Available | 33790 | Open in IMG/M |
| 3300025115|Ga0209835_1061396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300025635|Ga0208147_1150691 | Not Available | 541 | Open in IMG/M |
| 3300025646|Ga0208161_1131903 | Not Available | 646 | Open in IMG/M |
| 3300025889|Ga0208644_1015821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4920 | Open in IMG/M |
| 3300025889|Ga0208644_1052339 | Not Available | 2254 | Open in IMG/M |
| 3300025889|Ga0208644_1113652 | Not Available | 1306 | Open in IMG/M |
| 3300027608|Ga0208974_1017118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2281 | Open in IMG/M |
| 3300027683|Ga0209392_1000289 | Not Available | 11161 | Open in IMG/M |
| 3300027734|Ga0209087_1057933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300027743|Ga0209593_10030455 | All Organisms → Viruses | 2138 | Open in IMG/M |
| 3300027770|Ga0209086_10175888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300027798|Ga0209353_10060661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1731 | Open in IMG/M |
| 3300027805|Ga0209229_10391066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300027805|Ga0209229_10411882 | Not Available | 586 | Open in IMG/M |
| 3300027899|Ga0209668_10300423 | Not Available | 1030 | Open in IMG/M |
| 3300027904|Ga0209737_10187014 | Not Available | 2113 | Open in IMG/M |
| 3300027917|Ga0209536_100384535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
| 3300027963|Ga0209400_1037062 | Not Available | 2648 | Open in IMG/M |
| 3300028025|Ga0247723_1056671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300031673|Ga0307377_10679964 | Not Available | 726 | Open in IMG/M |
| 3300031758|Ga0315907_10331335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
| 3300031758|Ga0315907_10919966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300031758|Ga0315907_11054522 | Not Available | 582 | Open in IMG/M |
| 3300031758|Ga0315907_11137665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300031857|Ga0315909_10003347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19633 | Open in IMG/M |
| 3300031963|Ga0315901_10569464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 867 | Open in IMG/M |
| 3300033418|Ga0316625_100308870 | Not Available | 1132 | Open in IMG/M |
| 3300033521|Ga0316616_101854120 | Not Available | 794 | Open in IMG/M |
| 3300033816|Ga0334980_0139377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300034022|Ga0335005_0702369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300034103|Ga0335030_0814970 | Not Available | 546 | Open in IMG/M |
| 3300034106|Ga0335036_0057224 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300034106|Ga0335036_0736059 | Not Available | 579 | Open in IMG/M |
| 3300034356|Ga0335048_0003942 | Not Available | 11974 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.32% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.77% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.83% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.83% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.83% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.94% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.94% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.94% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.94% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.94% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.94% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.94% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.94% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.94% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.94% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.94% |
| Wastewater | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300002180 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 | Environmental | Open in IMG/M |
| 3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
| 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Host-Associated | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004901 | Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-EVs | Engineered | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006045 | Neocapritermes taracua P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P3 | Host-Associated | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027904 | Cubitermes ugandensis P3 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY92_100057754 | 3300000947 | Macroalgal Surface | MFKVTFYVYSKILNKECRNVEIHKSMDDARLRALALMWQIESVEEIN* |
| Draft_105564262 | 3300001605 | Hydrocarbon Resource Environments | MLKVTFYVYSKLLGKEFFNVETHRSMDDARLRACALSWTISKVEEV* |
| JGI24724J26744_100037322 | 3300002180 | Marine | MGEYKYRVTFYVYSKVLGKEFRNVELHRSEDDYRLRALALNWTVEKVEAL* |
| metazooDRAFT_12801592 | 3300002200 | Lake | MFQVTFYSFSKVLNKGFVNVEVHKSLNDARLRALALNWTIQSVEQI* |
| JGI24696J40584_129234623 | 3300002834 | Termite Gut | MTEYTIRVTFYVYSDILKREFINVELHRSIADARLRALALGWEIQSIEEVD* |
| JGI25908J49247_101424642 | 3300003277 | Freshwater Lake | MLKVTFYVFSQRLGKEFINVELHRSMDDARLWACALGWTISKVEAA* |
| JGI25921J50272_100005525 | 3300003430 | Freshwater Lake | MFQITFYSFSKVLNKGFINVEIHKSIDDAKLRASALHWSIQSVVKI* |
| JGI25913J50563_10058232 | 3300003431 | Freshwater Lake | MLKVTFYVFSQRLGKEFINIEIHRSMDDARLRACALGWTISKVEAA* |
| Ga0066222_11403253 | 3300004460 | Marine | MFKVTFHYYSKLLKRDFYNVEIYRSMDDARLRGCALNWTISSVENI* |
| Ga0068517_10024483 | 3300004901 | Wastewater | MLKVTFYVYSKLLGKEFFNVELHRSMDDAKLRACALGWTISKVEGV* |
| Ga0049081_100065026 | 3300005581 | Freshwater Lentic | MLKVTFYCFSDILNKGFVNVEYHKSIDNARLRAMALNWTIQSVEQI* |
| Ga0049081_101496181 | 3300005581 | Freshwater Lentic | SIDNNFSTEASMFKVTFYVYSKILNKECRNVEIHKSMDDARLRALALMWQIESVEEI* |
| Ga0079957_10350874 | 3300005805 | Lake | MFQVTFYAFSKVLNKGFVNVEIHKSLDDARLRALALNWTIQSVEQI* |
| Ga0075465_100793233 | 3300006037 | Aqueous | MLKVTFYVFSQRLGKEFINIELHRSMDDARLRACALGWTISKVEAA* |
| Ga0082212_101204851 | 3300006045 | Termite Gut | MNKYTIRVTFTVYSTILKREFVNVELHRSMDDARLRALALGWTIQKIEEVA* |
| Ga0075471_101721912 | 3300006641 | Aqueous | MLKVTFYVYSKLLGKEFFNVETHRSMDDARLRACALGWTISKVEEV* |
| Ga0070749_1000263324 | 3300006802 | Aqueous | MLKITFYVFSKVLGKEFRNVELHRSIDDARLRALALGWTIEKIEAA* |
| Ga0070749_100028914 | 3300006802 | Aqueous | MIKVTFYVYSKRLGKEFFNVELHRSMDDARLRACALGWTIHQVEEV* |
| Ga0070749_100200775 | 3300006802 | Aqueous | MFKVTFYVYSELLKKEFRNVETHRSLADARLRAMALNWQIEKVEQAS* |
| Ga0070749_100640653 | 3300006802 | Aqueous | MIKVTFYVYSKILNKEFYNVEVHKSIDDARLRAMALNWQIQKVEQV* |
| Ga0070749_101594203 | 3300006802 | Aqueous | MLRVTFYVYSSLLGREFRNVEIHRSIDDARLRACALNWSIEKIEEI* |
| Ga0070749_101708122 | 3300006802 | Aqueous | MIRVTYYVFSKILNREFINVEVHKSMDDARLRGLALGWTIQSVEPV* |
| Ga0070749_103693822 | 3300006802 | Aqueous | MFKVTFYVYSKILNKEFRNVEVHKSMDDARLRALALMWQIESVEEV* |
| Ga0070749_104685973 | 3300006802 | Aqueous | MLTVTFHVYSKLLGKEFFNVEQHRSIDDARLRALALGWTIHKVEEA* |
| Ga0075467_100987293 | 3300006803 | Aqueous | MLKVTFHVFSQRLGKEFINVEFHCSMDDARLRACALGWTISKVEAA* |
| Ga0075473_100632432 | 3300006875 | Aqueous | MLKVTFYVYSKLLGKEFFNVEMHRSMDDARLRACALNWTIHQVEEA* |
| Ga0102976_10897412 | 3300007169 | Freshwater Lake | MLKVTFYVYSKLLGKEFFNVEIHRSMDDARLRACALNWTIHQVEEA* |
| Ga0099851_10489362 | 3300007538 | Aqueous | MLKVTFYVYSKLLGKEFYNVEIHRSMDAARLRALALNWTIAEVEEV* |
| Ga0099848_10371924 | 3300007541 | Aqueous | MLKVTFYVYSKLLGKEFFNVEMHRSMDDARLRACALNWIIHKVEEA* |
| Ga0114343_10456003 | 3300008110 | Freshwater, Plankton | MFKVTFYVYSKILNKECRNVEIHKSMDDARLRALALMWQIESVEEV* |
| Ga0114363_10756722 | 3300008266 | Freshwater, Plankton | MFKVTFYAFSKVLNKGFVNVEIHKSLEDAKLRACALNWQIQEVEQI* |
| Ga0114363_12149381 | 3300008266 | Freshwater, Plankton | MIRVTFWTFSKLLNREFVNVEVHQSLADARLRAMALNWTISKVEHI* |
| Ga0114876_10669113 | 3300008448 | Freshwater Lake | MFQVTFYAFSKVLNKGFINVEIHKSLDDARLRACALNWTIQSVEQI* |
| Ga0114876_12240692 | 3300008448 | Freshwater Lake | MIKVTFYVYSKILNKEFYNVEVHRSIDDAKLRAMALNWQIHKVEQA* |
| Ga0114973_100846213 | 3300009068 | Freshwater Lake | MLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL* |
| Ga0105090_102703932 | 3300009075 | Freshwater Sediment | MIRVTFYVFSKILNREFINVEVHRSMDDARLRGLALGWTISKVEQI* |
| Ga0114968_102867692 | 3300009155 | Freshwater Lake | MFKVTFYVYCKVLNKEFRNIETHKSMDNARLRALALNWQIESVEQI* |
| Ga0114978_100706076 | 3300009159 | Freshwater Lake | LFRRIKMLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL* |
| Ga0114978_103959243 | 3300009159 | Freshwater Lake | LKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL* |
| Ga0114978_104581113 | 3300009159 | Freshwater Lake | MLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIE |
| Ga0114975_102675092 | 3300009164 | Freshwater Lake | MPQSSGLFGRIKMLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL* |
| Ga0105104_100480621 | 3300009168 | Freshwater Sediment | MLTVTFHVYSKLLGKEFFNVEQHRSMDDARLRALALGWTIYKVEEA* |
| Ga0114979_100642766 | 3300009180 | Freshwater Lake | RRIKMLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL* |
| Ga0136235_100150220 | 3300010233 | Freshwater | MLKVTFYVFSKILNKEFRNVEMHKSMDDAKLRACALNWQIESVEAA* |
| Ga0129333_101258515 | 3300010354 | Freshwater To Marine Saline Gradient | MDAITRTQLSSEAPMFKVTFYVYSKILNKEFRNVEVHKSMDDARLRALALMWQIESVEEV |
| Ga0129333_112462331 | 3300010354 | Freshwater To Marine Saline Gradient | MFKVTFYVYSKILNKECRNVEIHKSMDDARLRALALM |
| Ga0129336_100822911 | 3300010370 | Freshwater To Marine Saline Gradient | MFQVTFYAFSKVLNKGFTNVEIHKSLDDARLRALALNWQIQSVEQI* |
| Ga0136851_104381993 | 3300010413 | Mangrove Sediment | FYVYSKLLGKEFFNVELHRSMDDAKLRACALGWTISKVEGV* |
| Ga0116241_102509085 | 3300010429 | Anaerobic Digestor Sludge | MFQVTFYVFSTILNKEFRNVEIHKSMADANLRALALNWQIESVKEL* |
| Ga0137429_11806893 | 3300011437 | Soil | MFKVTFRSFSKVLNKEFFNVEIHRSMDDAKLRASALNWQVWKVEAA* |
| Ga0137362_117004021 | 3300012205 | Vadose Zone Soil | MFRVTFYVFSKVLGREFRNVEVHRLMADASLRASALGWTIEKVQPATAHLA |
| (restricted) Ga0172364_106870721 | 3300013129 | Sediment | MFKVTFYAFSKILNKGFVNVEVHKSLDDARLRALALNWTIESVEQI* |
| (restricted) Ga0172373_102209555 | 3300013131 | Freshwater | MFQVTFYSFSKVLNKSFINVEIHKSIDDAKLRASALHWTIQSVVQI* |
| (restricted) Ga0172373_107438511 | 3300013131 | Freshwater | AIHAEEGKMFQVTFYAFSKVLNKGFTNVEIHKSLDDARLRALALNWQIQSVEQI* |
| (restricted) Ga0172372_108551131 | 3300013132 | Freshwater | EEGKMFQVTFYAFSKVLNKGFTNVEIHKSLDDARLRALALNWQIQSVEQI* |
| (restricted) Ga0172376_101734393 | 3300014720 | Freshwater | MFQVTFYAFSKVLNKGFTNVEIHKSLDDARLRALALNWSIQSVEQI* |
| Ga0181350_10318593 | 3300017716 | Freshwater Lake | MLKVTFYVFSQRLGKEFINIELHRSMDDARLRACALGWTISKVEAA |
| Ga0181344_10181692 | 3300017754 | Freshwater Lake | MFKVTFHYYSKLLKRDFYNVEIHRSMDDARLRGCALNWTISSVENI |
| Ga0181346_10023755 | 3300017780 | Freshwater Lake | MNGRDEMLKVTFYVFSKVLNKEFRNVETHRSLADANLRALALNWTIEKVEQV |
| Ga0169931_107439272 | 3300017788 | Freshwater | MFKVTFYAFSKILNKGFVNVEVHKSLDDARLRALALNWTIESVEQI |
| Ga0180437_108256022 | 3300017963 | Hypersaline Lake Sediment | MLKVTFYVYSKLLGKEFFNVEMHRSMDDARLRACALNWIIHKVEEA |
| Ga0207193_100750345 | 3300020048 | Freshwater Lake Sediment | MFKITFYSYSKVLKKSFYNVEMHKSMEDVNLRAMALNWQICKVEQ |
| Ga0207193_13631182 | 3300020048 | Freshwater Lake Sediment | MLKVTFYVYSKLLGKEFFNVEMHRSMDDARLRACALNWTIHQVEEA |
| Ga0211736_107150161 | 3300020151 | Freshwater | MLKVTFYCFSQVLNKSFVNVEYHKSIDNARLRAMALNWTIQSVEQI |
| Ga0194035_10831004 | 3300020167 | Anoxic Zone Freshwater | MLKVTFYVFSQRLGKEFINVEFHRSMDDARLRACALGWTISKVEEA |
| Ga0181556_12328592 | 3300020176 | Salt Marsh | MLKVTFYVYSKLLGKEFFNVELHRSMDDAKLRACALGWTISKVEGV |
| Ga0211731_102891491 | 3300020205 | Freshwater | MFQVTFYSFSKVLNKGFINVEIHKSIDDAKLRASALHWSIQSVVQI |
| Ga0214162_10724772 | 3300021108 | Freshwater | MLKVTFYVFSQRLGKEFINIEIHRSMDDARLRACALGWTISKVEAA |
| Ga0181353_10648062 | 3300022179 | Freshwater Lake | MFQITFYSFSKVLNKGFINVEIHKSIDDAKLRASALHWSIQSVVKI |
| Ga0196905_10757573 | 3300022198 | Aqueous | MLKVTFYVYSKLLGKEFYNVEIHRSMDAARLRALALNWTIAEVEEV |
| Ga0224514_103347281 | 3300022217 | Sediment | MGEYKYRVTFYVYSKVLGKEFRNVELHRSEDDYRLRALALNWTVEKVEAL |
| Ga0214921_1000201819 | 3300023174 | Freshwater | MFKVTFHYYSKLLKRDFYNVEIHRSMDDARLRGCTLNWTISSVENI |
| Ga0209835_10613962 | 3300025115 | Anoxic Lake Water | MLKVTFYVYSKLLGKEFFNVELHRSMDDAKLRACALGWTISKIEGV |
| Ga0208147_11506912 | 3300025635 | Aqueous | MIKVTFYVYSKRLGKEFFNVELHRSMDDARLRACALGWTIHQVEEV |
| Ga0208161_11319033 | 3300025646 | Aqueous | MFQVTFYAFSKVLNKGFINVEVHKSLDDARLRALALNWTIQSVEQI |
| Ga0208644_10158214 | 3300025889 | Aqueous | MIKVTFYVYSKILNKEFYNVEVHKSIDDARLRAMALNWQIQKVEQV |
| Ga0208644_10523398 | 3300025889 | Aqueous | MFKVTFYVYSELLKKEFRNVETHRSLADARLRAMALNWQIEKVEQAS |
| Ga0208644_11136522 | 3300025889 | Aqueous | MLRVTFYVYSSLLGREFRNVEIHRSIDDARLRACALNWSIEKIEEI |
| Ga0208974_10171182 | 3300027608 | Freshwater Lentic | MLKVTFYCFSDILNKGFVNVEYHKSIDNARLRAMALNWTIQSVEQI |
| Ga0209392_10002893 | 3300027683 | Freshwater Sediment | MIRVTFYVFSKILNREFINVEVHRSMDDARLRGLALGWTISKVEQI |
| Ga0209087_10579333 | 3300027734 | Freshwater Lake | MLKVTFYVYSQLLKKEFRNIEIHTSMANANLRALALNWQIEKVEAL |
| Ga0209593_100304555 | 3300027743 | Freshwater Sediment | MLTVTFHVYSKLLGKEFFNVEQHRSMDDARLRALALGWTIYKVEEA |
| Ga0209086_101758883 | 3300027770 | Freshwater Lake | MFKVTFYVYSKILNRECRNVEIHKSMADANLRALALMWQIESVEQI |
| Ga0209353_100606612 | 3300027798 | Freshwater Lake | MLKVTFYVFSQRLGKEFINVELHRSMDDARLWACALGWTISKVEAA |
| Ga0209229_103910663 | 3300027805 | Freshwater And Sediment | MIRVTFWTFSKLLNREFVNVEVHQSLADARLRAMALNWTISKVEHI |
| Ga0209229_104118822 | 3300027805 | Freshwater And Sediment | MLRVTFYVYSPLLGREFRNVEIHRSIDDARLRACALNWSIEKIEEI |
| Ga0209668_103004232 | 3300027899 | Freshwater Lake Sediment | MLKVTFHVYSKLLGKEFFNVEMHRSMDDARLRACALNWTIHQVEEA |
| Ga0209737_101870142 | 3300027904 | Termite Gut | MGEYTIRVTFWVYSEILKKEFVNVELHRSLADARLRASALGWTISSVEAL |
| Ga0209536_1003845356 | 3300027917 | Marine Sediment | RTQLLSEALMFKVTFYVYSKILNKEFRNVEVHKSMDDARLRALALMWQIESVEEV |
| Ga0209400_10370625 | 3300027963 | Freshwater Lake | MFKVTFYVYCKVLNKEFRNIETHKSMDNARLRALALNWQIESVEQI |
| Ga0247723_10566714 | 3300028025 | Deep Subsurface Sediment | MFKVTFYVYSKILNKECRNVEIHKSMADANLRALALMWQIESVEEI |
| Ga0307377_106799641 | 3300031673 | Soil | MLKVTFYCFSDILNKGFVNVEYHKSLDNARLRAMALNWTIQSVEQI |
| Ga0315907_103313353 | 3300031758 | Freshwater | MDAAIRTQLLSEAFMFKVTFYVYSKILNKEFRNIEVHKSMDDARLRALALMWQIESVEEV |
| Ga0315907_109199662 | 3300031758 | Freshwater | VRVTKESNMLKVTFYVYSKLLGKEFFNVEIHRSLEDARLRASALNWTISQVEEV |
| Ga0315907_110545222 | 3300031758 | Freshwater | MFKVTFYAFSKVLNKGFVNVEIHKSLEDAKLRACALNWQIQEVEQI |
| Ga0315907_111376652 | 3300031758 | Freshwater | MFKVTFYVYSKILNKEFRNVEVHKSMDDARLRALALMWQIESVEEV |
| Ga0315909_1000334734 | 3300031857 | Freshwater | MFKVTFYVYSKILNKEFRNIEVHKSMDDARLRALALMWQIESVEEV |
| Ga0315901_105694643 | 3300031963 | Freshwater | MFQVTFYAFSKVLNKGFINVEIHKSLDDARLRACALNWTIQSVEQI |
| Ga0316625_1003088703 | 3300033418 | Soil | MIKVTFYVYSKILNKEFYNVEVHRSIDDAKLRAMALNWQIHKVEQA |
| Ga0316616_1018541202 | 3300033521 | Soil | MIKVTFYVYSKILNKEFYNVEVHRSIDNAKLRAMALNWQIHKVEQA |
| Ga0334980_0139377_335_475 | 3300033816 | Freshwater | MIKVTFYTYSKVLKREFRNVEVHKSMDDARLRALALNWIIEKVEQA |
| Ga0335005_0702369_402_533 | 3300034022 | Freshwater | MLKVTFHTYSKLLNKEFFNVETHRSLADANLRALALNWTIYKVE |
| Ga0335030_0814970_366_545 | 3300034103 | Freshwater | VHGIPPYCSEEDKMLKVTFYCFSDILNKGFVNVEYHKSIDNARLRAMALNWTIQSVEQI |
| Ga0335036_0057224_2209_2349 | 3300034106 | Freshwater | MFQVTFYCFSQVLNKSFINVEIHKSLDDARLRALALNWTIQSVEQI |
| Ga0335036_0736059_363_503 | 3300034106 | Freshwater | MFKVTFYVYSKVLNKEFRNVEIHKSMDDARLRALALMWQIESVEEV |
| Ga0335048_0003942_671_811 | 3300034356 | Freshwater | MLKVTFYVYSKVLDKEFFNTELHSSMDDARLRACALNWTISKVEEA |
| ⦗Top⦘ |