


| Basic Information | |
|---|---|
| Family ID | F093710 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNWQDMYEVALERIRQLNREVTLLGTILRAYLPIIEKDKDEKR |
| Number of Associated Samples | 47 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.26 % |
| % of genes near scaffold ends (potentially truncated) | 16.98 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 40 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.226 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (79.245 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.057 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03592 | Terminase_2 | 1.89 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.23 % |
| All Organisms | root | All Organisms | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 79.25% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 13.21% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.89% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.94% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006988 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009613 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025257 | Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25134J35505_101205491 | 3300002518 | Marine | MNWQDMYEVALERIKQLNKEVKTLGTILRAYLPVIEKDDDEKR* |
| FS896DNA_102738812 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MNWQDMYEVALERIRQLKREVDTLGTILRAYLPIIEEDKHEKR* |
| Ga0082018_10587492 | 3300006091 | Marine | MNWQDMYEVALERIRQLNKEVSTLGTILRAYLPIIEKDDDEKR* |
| Ga0098033_10294876 | 3300006736 | Marine | MNWQDMYEVALERIRQLNREVTLLGEILRAYLPIIEKDEDEKR* |
| Ga0098033_10411842 | 3300006736 | Marine | MDWKGMYEAALERVKQLNKDVSVLEGILRAYLPIVEKDKNEKR* |
| Ga0098033_10534001 | 3300006736 | Marine | MKWQDMYEVALERIRQLNREVTLLGSILRAYLPIIEKDKDEKR* |
| Ga0098033_10651412 | 3300006736 | Marine | MNWQDMYEVALERIRQLNREVTLLGNILRAYLPIIEKDKDEKR* |
| Ga0098033_10699832 | 3300006736 | Marine | MDWKGMYEAALERVKQLNRDVSLLEAILRSYLPIVEKDKDEKR* |
| Ga0098033_10724004 | 3300006736 | Marine | MNWQDMYEVALERVRQLNAELSVIKEILRSYLPIIEKDKDEKR* |
| Ga0098033_10776742 | 3300006736 | Marine | MNWQDMYEVALERIRQLNREVTLLGEILRAYLPVIEKDKDEKR* |
| Ga0098033_11063842 | 3300006736 | Marine | MNWQDMYEVALERVQQLNDDVHLLEEILRSYLPIVEKEKDEKR* |
| Ga0098033_11092242 | 3300006736 | Marine | MNWQDMYEVALERIKQLNSEVKLLGEILRSYLPII |
| Ga0098033_11105421 | 3300006736 | Marine | MNWQDMYEVALERIKQLNKEVTLLSKILRSYLPIIEKE |
| Ga0098033_11209762 | 3300006736 | Marine | MNWQDMYEVALERIRQLNKEVTLLGTILRAYLPVIEKD |
| Ga0098035_10255172 | 3300006738 | Marine | MKWQDMYEVALERIRQLNREVTLLGTILRAYLPIIEKDKDEKR* |
| Ga0098035_10534203 | 3300006738 | Marine | MNWQDMYEVTLERVRQLNRELGLLKEILRSYLPIIEKDKDEKR* |
| Ga0098035_10536052 | 3300006738 | Marine | MLYTYPMNWQDMYEAALERIRQLNAEVTTLGTILRSYLPIIEKDDDEKR* |
| Ga0098035_11292362 | 3300006738 | Marine | MNWQDMYEVALERIRQLNREVTLLGTILRAYLPVIEKDKDEKR* |
| Ga0098035_11809592 | 3300006738 | Marine | MNWQDMYEVALDRIKQLNAELSVLKEILRSYLPIVEKKDKDEKR* |
| Ga0098035_13097812 | 3300006738 | Marine | MNWQDMYEVALERIRQLNREVTLLGSILRAYLPIIEKDKDEKR* |
| Ga0098058_11325571 | 3300006750 | Marine | MYEVTLERIRQLNAEIHVLKEILRSYLPVIERDKDEKR* |
| Ga0098039_100092913 | 3300006753 | Marine | VEEVKWRDMYEAALERITELNRDVTLLNAILRSYLPILEKKDKDEKR* |
| Ga0098039_10710093 | 3300006753 | Marine | MNWQDMYEVALERIKQLNKEVTLLSKILRSYLPIIEKEDDEKR* |
| Ga0098039_10759592 | 3300006753 | Marine | MNWQDMYEVALERIKQLNQDVDVLEKILQSYLPIVIKEETNEKR* |
| Ga0098039_11032692 | 3300006753 | Marine | MNWQDMYEVALERVKQLNDDVHLLEEILRSYLPIVEKEKDEKR* |
| Ga0098039_11140903 | 3300006753 | Marine | MNWQDMYEVALERIKQLNSEVKLLGEILRSYLPIIEKEDNETR* |
| Ga0098039_11293071 | 3300006753 | Marine | MYEVTLERVRQLNAELHVLKEILRSYLPVIEKDKDEKR* |
| Ga0098039_11527843 | 3300006753 | Marine | MNWQDMYEVALERIRQLNREVTLLGTILRAYLPIIEKDKDEKR* |
| Ga0098039_11900762 | 3300006753 | Marine | MNWQDMYEVALERIKQLNQEVSLIKAILRSYLPILEEKDKDEKR* |
| Ga0098039_12085391 | 3300006753 | Marine | MNWQDMYEVALERIRQLNIEVNTLGAILRSYLPIIEKDEDEKR* |
| Ga0098039_12170541 | 3300006753 | Marine | MKWQDMYEVALERIRQLNREVTLLGNILRAYLPVIEKDKDEKR* |
| Ga0098039_12391562 | 3300006753 | Marine | HLCVLTLPMNWQDMYEVALERIKQLNTEIAVIKEILRSYLPIVEKKDKDEKR* |
| Ga0098039_12424952 | 3300006753 | Marine | MYEVTLERVKQLNEEVRLLSEILRSYLPIMEKEDNEKR* |
| Ga0098039_13111102 | 3300006753 | Marine | MNWQDMYECALERIKQLNQDLGVLQEILRSYLPILEKSNNEKR* |
| Ga0098039_13227061 | 3300006753 | Marine | YIYHMNWQDMYEVALERIRQLNREVTLLGEILRAYLPVIEKDKDEKR* |
| Ga0098044_10129348 | 3300006754 | Marine | MNWQDMYEVTLVRIRQLNAEISVLREILRSYLPVIEKDKDEKR* |
| Ga0098044_10576663 | 3300006754 | Marine | MNWQDMYEVTLERVTQLNKDVAQLEEILRSYLPVIEKDEYEKR* |
| Ga0098044_10828753 | 3300006754 | Marine | MLYTYPMNWQDMYEAALERIRQLNKEVDTLGTMLRAYLPVLSIDNSAKDPNEKR* |
| Ga0098044_11067321 | 3300006754 | Marine | VALERIRQLNREVTLLGSILRAYLPIIEKDKDEKR* |
| Ga0098044_11987771 | 3300006754 | Marine | MKWQDMYEVALERIRQLNREVTLLGNILRAYLPIIEKDKDEKR* |
| Ga0098044_12663541 | 3300006754 | Marine | MNWQDMYECALERIKQLNKDVDVLETILRSYLPVITKDNNEKR* |
| Ga0098044_13571721 | 3300006754 | Marine | MNWQDMYEVALERIKQLNQEVRLLGEILRSYLPIIEKEDNEKR* |
| Ga0098054_12172382 | 3300006789 | Marine | MKWQDMYEVALERIRQLNREVTLLGSILRAYLPVIEKDEDEKR* |
| Ga0098054_12474793 | 3300006789 | Marine | MNWQDMYEVALQRIKQLNKEVDVLENILQSYLPIVVKEPDEKR* |
| Ga0098055_11917262 | 3300006793 | Marine | MNWQDMYEVALERIRQLNREVTLLGSILRAYLPIIEKDEDEKR* |
| Ga0098057_11012472 | 3300006926 | Marine | MDWEGMYEATLERVKQLNRDVSILEGILRAYLPIVEKDKNEKR* |
| Ga0098057_11381752 | 3300006926 | Marine | VKWRDMYEAALERITELNRDVTLLNAILRSYLPILEKKDKDEKR* |
| Ga0098034_100242711 | 3300006927 | Marine | ALERIRQLNREVTLLGTILRAYLPIIEKDKDEKR* |
| Ga0098034_10597292 | 3300006927 | Marine | MNWQDMYEVALDRIKQLNTELTLLKTILRSYLPIVDKKDKDEKR* |
| Ga0098034_11052521 | 3300006927 | Marine | MDWKGMYEVALDRVRQLNRDISLLEAILRSYLPIVEKDKDEKR* |
| Ga0098034_11127571 | 3300006927 | Marine | MNWQDMYEVTLERVKQLNEEVRLLSEILRSYLPIMEKEDDEKR* |
| Ga0098034_11166952 | 3300006927 | Marine | MNWQDMYEVALERIRQLNREVTLLGTILRAYLPIIEKDEDEKR* |
| Ga0098034_11204662 | 3300006927 | Marine | MYEVALERVRQLNADIAVLQEILRSYLPIIEKDENEKR* |
| Ga0098034_11550082 | 3300006927 | Marine | MNWQDMYEVALERIRQLNREVTLLGSILRAYLPVIEKDKDEKR* |
| Ga0098034_11568672 | 3300006927 | Marine | MNWQDMYEVALERIRQLNREVTLLGEILRAYLPIMEKDKDEKR* |
| Ga0098034_11616981 | 3300006927 | Marine | MNWQDMYECALERIKQLNTDLRVVQEILRSYLPVITKDDNEKR* |
| Ga0098064_1511232 | 3300006988 | Marine | MNWQDMYEVALERIRQLNREVTLLGTILRAYLPVIEKDEDEKR* |
| Ga0110931_11849152 | 3300007963 | Marine | YYIYHMNWQDMYEVALERIRQLNREVTLLGSILRAYLPIIEKDKDEKR* |
| Ga0098052_12893612 | 3300008050 | Marine | MNWQDMYEVSLERIKQLNKEVDVLQAILRSYLPIVDIKNIERNQNEKR* |
| Ga0098052_13788572 | 3300008050 | Marine | MDWKGMYEAALERVKQLNRDISLLESILRSYLPIVEKDKDEKR* |
| Ga0114898_10136433 | 3300008216 | Deep Ocean | MNWQDMYEVTLERVKQLNQELHLLKEILRSYLPIIEKDKDEER* |
| Ga0114898_10405133 | 3300008216 | Deep Ocean | MNWQDMYEAALERIRQLNAEVATLGTILRAYLPVIEKDEDEKR* |
| Ga0114898_11390742 | 3300008216 | Deep Ocean | MYEVALDRVRQLNADIAVLQEILRSYLPIIEKDENEKR* |
| Ga0114904_11592481 | 3300008218 | Deep Ocean | MNWQDMYEVTLERVKQLKQELHLLKEILRSYLPIIEKDKDEER* |
| Ga0114902_11701951 | 3300009413 | Deep Ocean | MYECALERIKQLNKELKIIREILRSYLPIIEKDNNEKR* |
| Ga0114909_11592332 | 3300009414 | Deep Ocean | MNWRDMYEVALDRVRQLNADIAVLQEILRSYLPIIEKDENEKR* |
| Ga0114908_12064602 | 3300009418 | Deep Ocean | MYEVALERIRQLNAELAIAREILRSYLPIVDNKEIDDEKR* |
| Ga0105214_1149462 | 3300009595 | Marine Oceanic | MNWQDMYEVALERIRQLNAEVATLGTILRAYLPIIEKDNDEKR* |
| Ga0114900_11326572 | 3300009602 | Deep Ocean | MTWRDIYEVPLDRVRQLNKDITVLQEILRSYLPIIEKDENEKR* |
| Ga0114901_11500391 | 3300009604 | Deep Ocean | RVLLFLTLPMNWQDMYEVALERIRQLNAELAIAREILRSYLPIVDNKEIDDEKR* |
| Ga0114906_10277251 | 3300009605 | Deep Ocean | MNWQDMYEVALERIRQLNAEVATLGTILRAYLPVIEKDEDEKR* |
| Ga0105228_1136482 | 3300009613 | Marine Oceanic | MYEVALERIKQLNQEVKLLGQILRSYLPIIEKEDNEKR |
| Ga0098061_11267511 | 3300010151 | Marine | MNWQDMYEVALERIKQLNSELGLLKEILRSYLPIIDKDKDEKR* |
| Ga0098047_100136577 | 3300010155 | Marine | MDWKGMYEAALERVKQLNKDVSVLEGILRAYLPIVEKDKDEKR* |
| Ga0098047_100910352 | 3300010155 | Marine | MYEVSLERIKQLNKEVTLLGKILRSYLPIIEKEDDEKR* |
| Ga0098047_101654663 | 3300010155 | Marine | LTLPMNWQDMYEVTLERVRQLNAELHVLKEILRSYLPIIEKDKDEKR* |
| Ga0098047_102167231 | 3300010155 | Marine | SPCLYYIYHMKWQDMYEVALERIRQLNREVTLLGTILRAYLPVIEKDKDEKR* |
| Ga0098047_102548162 | 3300010155 | Marine | MNWQDMYEVALERVRQLNQEIRLLTTILRSYLPIIEEDKHEKR* |
| Ga0098047_102998981 | 3300010155 | Marine | MYEVALDRIKQLNAELSVLKEILRSYLPIVEKKDKDEKR* |
| Ga0098047_103318621 | 3300010155 | Marine | WQDMYECALERIKQLNKDVDVLETILRSYLPIITKDNNEKR* |
| Ga0181374_10092575 | 3300017702 | Marine | MNWQDMYEVALERIRQLNREVTLLGSILRAYLPIIEKDKDEKR |
| Ga0181375_10286012 | 3300017718 | Marine | MYEVTLERVRQLNAELHVLKEILRSYLPIIEKDKDEKR |
| Ga0181432_10955432 | 3300017775 | Seawater | MYEVTLERVTQLNKEVNVLEEILRAYLPVIEKDNDEKR |
| Ga0181432_12861072 | 3300017775 | Seawater | MSMNWQTLYEVALERVKQLNEEVSLLHTILRSYLPILEKDENEKR |
| (restricted) Ga0255049_100963692 | 3300024517 | Seawater | MKWQDMYEVALERIRQLNREVTLLGTILRAYLPVIEKDKDEKR |
| Ga0208920_10110732 | 3300025072 | Marine | MDWKGMYEAALERVKQLNRDVSLLEAILRSYLPIVEKDKDEKR |
| Ga0208668_10770072 | 3300025078 | Marine | VEEVKWRDMYEAALERITELNRDVTLLNAILRSYLPILEKKDKDEKR |
| Ga0208156_10487672 | 3300025082 | Marine | MYEVALERVRQLNAELSVIKEILRSYLPIIEKDKDEKR |
| Ga0208553_10803381 | 3300025109 | Marine | MNWQDMYEVALERVKQLNDDVHLLEEILRSYLPIVEKEKDEKR |
| Ga0209349_10196312 | 3300025112 | Marine | MNWQDMYEVALERIKQLNKEVKTLGTILRAYLPVIEKDDDEKR |
| Ga0209349_11737981 | 3300025112 | Marine | MNWQDMYEVTLERVRQLNRELGLLKEILRSYLPIIEKDKDEKR |
| Ga0208790_10070128 | 3300025118 | Marine | MNWQDMYEVTLERVRQLNAELHVLKEILRSYLPIIEKDKDEKR |
| Ga0209434_11156412 | 3300025122 | Marine | VKWRDMYEAALERITELNRDVTLLNAILRSYLPILEKKDKDEKR |
| Ga0209644_10363652 | 3300025125 | Marine | MNWQDMYEVALERIRQLNKEVSTLGAILRAYLPIIEKDDDEKR |
| Ga0209128_10520742 | 3300025131 | Marine | MYEVALERIKQLNKEVKTLGTILRAYLPVIEKDDDEKR |
| Ga0209128_10590572 | 3300025131 | Marine | MNWQDMYEVTLDRVYQLNKDIAILEAILRSYLPVLKKDNNEER |
| Ga0209128_11722502 | 3300025131 | Marine | MNWQDMYEVALERIRQLNREVTLLGEILRAYLPIIEKDEDEKR |
| Ga0209756_11810923 | 3300025141 | Marine | MNWQDMYEVALERIRQLNKEVATLGTILRAYLPIIEKDEDEKR |
| Ga0209756_12399232 | 3300025141 | Marine | MDWEGMYESALERVKQLNRDISVLKEILRSYLPIVEKGKDEER |
| Ga0207899_10627602 | 3300025257 | Deep Ocean | MNWQDMYEVALERIRQLNAEVATLGTILRAYLPVIEKDEDEKR |
| Ga0208813_10340153 | 3300025270 | Deep Ocean | MNWQDMYEVTLERVKQLNQELHLLKEILRSYLPIIEKDKDEER |
| Ga0208183_10604812 | 3300025274 | Deep Ocean | MNWQDMYEAALERIRQLNAEVATLGTILRAYLPVIEKDEDEKR |
| Ga0208030_10451632 | 3300025282 | Deep Ocean | MNWRDMYEVALDRVRQLNADIAVLQEILRSYLPIIEKDENEKR |
| Ga0209757_101565891 | 3300025873 | Marine | MDWKGMYEVALERVKQLNKDVSVLEGILRAYLPIVEKEKNEER |
| Ga0310345_104545194 | 3300032278 | Seawater | CALYIYLMNWQDMYAVALERIRQLNKEVDTLGTILRAYLPVIEEDNDEKR |
| Ga0310345_114118201 | 3300032278 | Seawater | MNWQDMYAVALERIRQLNKEVDTLGTILRAYLPVIE |
| ⦗Top⦘ |