


| Basic Information | |
|---|---|
| Family ID | F093695 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKRQAIKYLGWALLYMGKPFTCIGNWFWKLHRKVLDWNK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 47.62 % |
| % of genes near scaffold ends (potentially truncated) | 40.57 % |
| % of genes from short scaffolds (< 2000 bps) | 71.70 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.340 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (13.207 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.151 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.792 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 5.66 |
| PF00848 | Ring_hydroxyl_A | 4.72 |
| PF03237 | Terminase_6N | 2.83 |
| PF11351 | GTA_holin_3TM | 2.83 |
| PF00145 | DNA_methylase | 0.94 |
| PF00622 | SPRY | 0.94 |
| PF00959 | Phage_lysozyme | 0.94 |
| PF01476 | LysM | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 9.43 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.66 % |
| Unclassified | root | N/A | 44.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10004108 | Not Available | 10607 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10048274 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10069545 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10132807 | Not Available | 849 | Open in IMG/M |
| 3300000947|BBAY92_10098197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 780 | Open in IMG/M |
| 3300000949|BBAY94_10028282 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300003908|JGI26085J52751_1026992 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300004097|Ga0055584_100158103 | All Organisms → Viruses → Predicted Viral | 2288 | Open in IMG/M |
| 3300004448|Ga0065861_1008379 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300004448|Ga0065861_1026550 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300004457|Ga0066224_1133483 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300004460|Ga0066222_1001445 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300004831|Ga0069134_173136 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300005057|Ga0068511_1018266 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300005512|Ga0074648_1025427 | All Organisms → Viruses → Predicted Viral | 3143 | Open in IMG/M |
| 3300005512|Ga0074648_1049920 | All Organisms → Viruses → Predicted Viral | 1828 | Open in IMG/M |
| 3300006026|Ga0075478_10014417 | All Organisms → Viruses → Predicted Viral | 2689 | Open in IMG/M |
| 3300006027|Ga0075462_10012794 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
| 3300006752|Ga0098048_1004051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5834 | Open in IMG/M |
| 3300006752|Ga0098048_1219410 | Not Available | 559 | Open in IMG/M |
| 3300006752|Ga0098048_1226219 | Not Available | 549 | Open in IMG/M |
| 3300006793|Ga0098055_1000954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 16073 | Open in IMG/M |
| 3300006793|Ga0098055_1172496 | Not Available | 827 | Open in IMG/M |
| 3300006793|Ga0098055_1399429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 509 | Open in IMG/M |
| 3300006810|Ga0070754_10510063 | Not Available | 517 | Open in IMG/M |
| 3300006868|Ga0075481_10002108 | Not Available | 7958 | Open in IMG/M |
| 3300006868|Ga0075481_10361074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED95 | 501 | Open in IMG/M |
| 3300006916|Ga0070750_10018923 | All Organisms → Viruses → Predicted Viral | 3514 | Open in IMG/M |
| 3300006916|Ga0070750_10144207 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300006916|Ga0070750_10314744 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 667 | Open in IMG/M |
| 3300006919|Ga0070746_10178709 | Not Available | 1021 | Open in IMG/M |
| 3300006922|Ga0098045_1088693 | Not Available | 735 | Open in IMG/M |
| 3300006928|Ga0098041_1178068 | Not Available | 682 | Open in IMG/M |
| 3300007539|Ga0099849_1215007 | Not Available | 718 | Open in IMG/M |
| 3300007539|Ga0099849_1228711 | Not Available | 690 | Open in IMG/M |
| 3300007778|Ga0102954_1006661 | All Organisms → Viruses → Predicted Viral | 3305 | Open in IMG/M |
| 3300009000|Ga0102960_1067924 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300009001|Ga0102963_1020065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2822 | Open in IMG/M |
| 3300009001|Ga0102963_1299411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 633 | Open in IMG/M |
| 3300009193|Ga0115551_1018325 | All Organisms → Viruses → Predicted Viral | 3696 | Open in IMG/M |
| 3300009193|Ga0115551_1317441 | Not Available | 679 | Open in IMG/M |
| 3300009423|Ga0115548_1105863 | Not Available | 913 | Open in IMG/M |
| 3300009437|Ga0115556_1084240 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300009443|Ga0115557_1299320 | Not Available | 606 | Open in IMG/M |
| 3300009476|Ga0115555_1243307 | Not Available | 732 | Open in IMG/M |
| 3300009507|Ga0115572_10758030 | Not Available | 524 | Open in IMG/M |
| 3300010153|Ga0098059_1182412 | Not Available | 821 | Open in IMG/M |
| 3300010296|Ga0129348_1143907 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 827 | Open in IMG/M |
| 3300010296|Ga0129348_1263685 | Not Available | 578 | Open in IMG/M |
| 3300010300|Ga0129351_1287907 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 623 | Open in IMG/M |
| 3300011013|Ga0114934_10122533 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1247 | Open in IMG/M |
| 3300012953|Ga0163179_11362018 | Not Available | 633 | Open in IMG/M |
| 3300013188|Ga0116834_1040195 | Not Available | 853 | Open in IMG/M |
| 3300017726|Ga0181381_1074698 | Not Available | 727 | Open in IMG/M |
| 3300017739|Ga0181433_1135970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 583 | Open in IMG/M |
| 3300017745|Ga0181427_1064868 | Not Available | 898 | Open in IMG/M |
| 3300017749|Ga0181392_1000648 | Not Available | 13263 | Open in IMG/M |
| 3300017749|Ga0181392_1023931 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300017749|Ga0181392_1208091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 560 | Open in IMG/M |
| 3300017749|Ga0181392_1227474 | Not Available | 529 | Open in IMG/M |
| 3300017750|Ga0181405_1108977 | Not Available | 695 | Open in IMG/M |
| 3300017759|Ga0181414_1059341 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300017765|Ga0181413_1046974 | Not Available | 1341 | Open in IMG/M |
| 3300017771|Ga0181425_1254787 | Not Available | 542 | Open in IMG/M |
| 3300017773|Ga0181386_1207076 | Not Available | 588 | Open in IMG/M |
| 3300017818|Ga0181565_10011023 | Not Available | 6811 | Open in IMG/M |
| 3300017824|Ga0181552_10235513 | Not Available | 928 | Open in IMG/M |
| 3300017950|Ga0181607_10656676 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 547 | Open in IMG/M |
| 3300017967|Ga0181590_10590183 | Not Available | 761 | Open in IMG/M |
| 3300017985|Ga0181576_10012547 | Not Available | 5950 | Open in IMG/M |
| 3300018416|Ga0181553_10037558 | All Organisms → Viruses → Predicted Viral | 3340 | Open in IMG/M |
| 3300018420|Ga0181563_10317629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 906 | Open in IMG/M |
| 3300019703|Ga0194021_1002685 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300020174|Ga0181603_10151593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1005 | Open in IMG/M |
| 3300020207|Ga0181570_10029005 | All Organisms → Viruses → Predicted Viral | 3413 | Open in IMG/M |
| 3300020388|Ga0211678_10417841 | Not Available | 529 | Open in IMG/M |
| 3300020440|Ga0211518_10003063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 12701 | Open in IMG/M |
| 3300020440|Ga0211518_10037733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 2859 | Open in IMG/M |
| 3300021185|Ga0206682_10014098 | Not Available | 5421 | Open in IMG/M |
| 3300021335|Ga0213867_1139534 | Not Available | 839 | Open in IMG/M |
| 3300021379|Ga0213864_10515734 | Not Available | 597 | Open in IMG/M |
| 3300021957|Ga0222717_10373669 | Not Available | 795 | Open in IMG/M |
| 3300021958|Ga0222718_10027178 | All Organisms → Viruses → Predicted Viral | 3878 | Open in IMG/M |
| 3300021958|Ga0222718_10039064 | All Organisms → Viruses → Predicted Viral | 3101 | Open in IMG/M |
| 3300021958|Ga0222718_10122836 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300021964|Ga0222719_10226415 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300022074|Ga0224906_1003728 | Not Available | 6659 | Open in IMG/M |
| 3300022074|Ga0224906_1035144 | All Organisms → Viruses → Predicted Viral | 1686 | Open in IMG/M |
| 3300022927|Ga0255769_10320580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 620 | Open in IMG/M |
| 3300024344|Ga0209992_10320908 | Not Available | 628 | Open in IMG/M |
| 3300025070|Ga0208667_1010265 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
| 3300025084|Ga0208298_1001884 | All Organisms → Viruses | 7372 | Open in IMG/M |
| 3300025617|Ga0209138_1013946 | All Organisms → Viruses → Predicted Viral | 4017 | Open in IMG/M |
| 3300025690|Ga0209505_1164070 | Not Available | 580 | Open in IMG/M |
| 3300025712|Ga0209305_1176459 | Not Available | 638 | Open in IMG/M |
| 3300025751|Ga0208150_1222365 | Not Available | 577 | Open in IMG/M |
| 3300025816|Ga0209193_1016887 | All Organisms → Viruses → Predicted Viral | 2381 | Open in IMG/M |
| 3300025822|Ga0209714_1078324 | Not Available | 970 | Open in IMG/M |
| 3300025830|Ga0209832_1223895 | Not Available | 516 | Open in IMG/M |
| 3300025849|Ga0209603_1073851 | All Organisms → Viruses → Predicted Viral | 1641 | Open in IMG/M |
| 3300026187|Ga0209929_1077800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 892 | Open in IMG/M |
| 3300029448|Ga0183755_1000352 | All Organisms → Viruses | 27942 | Open in IMG/M |
| 3300029448|Ga0183755_1039751 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300032136|Ga0316201_11239046 | Not Available | 623 | Open in IMG/M |
| 3300032274|Ga0316203_1006385 | All Organisms → Viruses → Predicted Viral | 4014 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.21% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.26% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 12.26% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.32% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.43% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.77% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.83% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.89% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.89% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.89% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.94% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.94% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.94% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.94% |
| Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.94% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300003908 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000410816 | 3300000101 | Marine | MRKQAVKYFGWALLYMGKPFTAIGNWFWKMHKRVLDWNDNARP* |
| DelMOWin2010_100482746 | 3300000117 | Marine | EAIKYLGWALLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| DelMOWin2010_100695453 | 3300000117 | Marine | MIKCIKKEAIKYLGWALLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| DelMOWin2010_101328073 | 3300000117 | Marine | MIKCIKKEAIKYLGWALLWMGKPFTSIGNWFWKLHRKVLD |
| BBAY92_100981973 | 3300000947 | Macroalgal Surface | MKRKAIKYLGWTLLYMGRPFTKIGDWFWKRHRDVLDWNK* |
| BBAY94_100282823 | 3300000949 | Macroalgal Surface | MKRKAIKYLGWGLLYMGKPFTRIGNWCWKKHRTVLDWND* |
| JGI26085J52751_10269922 | 3300003908 | Marine | MKRKAITYLGWGLLYVGRPFTCIGNWFWKKHKQVLDWNDK* |
| Ga0055584_1001581032 | 3300004097 | Pelagic Marine | MMKRQAIKYLGWALLYMGKPFTCVGNWFWKLHRKVLDWNK* |
| Ga0065861_10083792 | 3300004448 | Marine | MKHSLNTYLGWGLLYMGKPFTRIGNWFWKKHKQVLNWNDPK* |
| Ga0065861_10265501 | 3300004448 | Marine | MKYSWNTYLGWGLLYMGKPFTRIGNWFWKKHKEVLNWNDPK* |
| Ga0066224_11334832 | 3300004457 | Marine | MKHNLNTYLGWGLLYVGKPFTRIGNWFWKKHKQVLNWNDPK* |
| Ga0066222_10014454 | 3300004460 | Marine | MKHSLNTYLGWGLLYVGKPFTRIGNWFWKKHKQVLNWNDPK* |
| Ga0069134_1731362 | 3300004831 | Surface Seawater | MRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWNK* |
| Ga0068511_10182663 | 3300005057 | Marine Water | MKRAAVRYLGWGLLYICKFFSAIANWFWKKHKRVLDWNDR* |
| Ga0074648_10254272 | 3300005512 | Saline Water And Sediment | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHKRVLDWNDNA* |
| Ga0074648_10499205 | 3300005512 | Saline Water And Sediment | MKRQAIKYLGWALLYIGKPFTYIGNWFWKMHRKVLDWNNK* |
| Ga0075478_100144171 | 3300006026 | Aqueous | MRKQAVKYFGWALLYMGKPFTAIGDWFWKKHRDVLDWNDNARP* |
| Ga0075462_100127949 | 3300006027 | Aqueous | MKRTAIKYFGWGLLYVCRFFSGIANWFWKKHKHVLDWNDR* |
| Ga0098048_100405110 | 3300006752 | Marine | MKRKLIAHLGLGLLYMGKPFTCVGNWFWRMHRTVLDWNDK* |
| Ga0098048_12194101 | 3300006752 | Marine | MKRTCIKYMGWALLYMGKPFTCMGNWFWRMHRTVLDWNDK* |
| Ga0098048_12262192 | 3300006752 | Marine | MKKRAIKYLGLTLLYMGRPFTKIGNWFWKKHRTVLDWND* |
| Ga0098055_100095420 | 3300006793 | Marine | MRKQAVKYFGWALLYMGKPFTRVGNWFWKMHKRVLDWNDNA* |
| Ga0098055_11724963 | 3300006793 | Marine | MKRTAVRYLGWGLLYVCKFFSAIANWFWKKHKHVL |
| Ga0098055_13994292 | 3300006793 | Marine | MKRKLIAHLGLGLLYMGKPFTCVGNWFWRKHKKVLDLLD* |
| Ga0070754_105100633 | 3300006810 | Aqueous | MKRQAIKYLGWALLYMGKPFTCVGNWFWKKHRDVLDWNKK* |
| Ga0075481_1000210821 | 3300006868 | Aqueous | LVKNVGWALLYMGKPFTAVGNWFWKKHRAVLDWNNK* |
| Ga0075481_103610741 | 3300006868 | Aqueous | KLKRILVRYAGWALLYMGRPFTATGNWFWKMHRKVLNINK* |
| Ga0070750_100189232 | 3300006916 | Aqueous | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVLDWNK* |
| Ga0070750_101442071 | 3300006916 | Aqueous | PFLIRRLGWVLLSMGKPFTCVGNWFWKKHRTVLDWNKK* |
| Ga0070750_103147441 | 3300006916 | Aqueous | VKYFGWGLLYMGKPFTAVGNWFWKLHRKVLDMND* |
| Ga0070746_101787094 | 3300006919 | Aqueous | RAAVRYLGWGLLYICKFFSAIANWFWKKHKRVLDWND* |
| Ga0098045_10886933 | 3300006922 | Marine | MRKQAVKYFGLALLYMGKPFTRVGNWFWKMHKRVLDWNDNA* |
| Ga0098041_11780682 | 3300006928 | Marine | MKKCAIKYLGLTLLYMGRPFTKIGDWFWKKHRTVLDWND* |
| Ga0099849_12150073 | 3300007539 | Aqueous | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVL |
| Ga0099849_12287111 | 3300007539 | Aqueous | KEMIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVLDWNK* |
| Ga0102954_10066614 | 3300007778 | Water | MRKQAVKYFGWALLYMGKPFTCVGNWFWKMHKRVLDWNDNA* |
| Ga0102960_10679241 | 3300009000 | Pond Water | SIRYLGWALLYMGKPFTRIGNWFWKLHRTVLNWNDK* |
| Ga0102963_10200651 | 3300009001 | Pond Water | FRRYLIKYIGWGLLYCGKPFTSVGNWFWKLHRKVLNWDKK* |
| Ga0102963_12994111 | 3300009001 | Pond Water | KMKRKAITYLGWGLLYMGRPFTCIGNWFWKKHKQVLDWND* |
| Ga0115551_10183257 | 3300009193 | Pelagic Marine | MIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| Ga0115551_13174411 | 3300009193 | Pelagic Marine | KYFGWALLYMGKPFTAIGNWFWKMHKRVLDWNDNARP* |
| Ga0115548_11058632 | 3300009423 | Pelagic Marine | MIKCIKKETIKYLGWALLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| Ga0115556_10842401 | 3300009437 | Pelagic Marine | NDAWWDGEKEMIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| Ga0115557_12993201 | 3300009443 | Pelagic Marine | MIKCIKKEAIKYLGWALLWMGKPFTCVGNWFWKLHRKVLDWNK* |
| Ga0115555_12433071 | 3300009476 | Pelagic Marine | KEMIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK* |
| Ga0115572_107580301 | 3300009507 | Pelagic Marine | KEEMRKQAVKYFGWALLYMGKPFTAIGNWFWKMHKRVLDWNDNARP* |
| Ga0098059_11824121 | 3300010153 | Marine | NVTNLKRTLVKYLGWALLYVGKPFTSVGNWFWRKHRTVLDWNNNGS* |
| Ga0129348_11439072 | 3300010296 | Freshwater To Marine Saline Gradient | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVLDWNN* |
| Ga0129348_12636852 | 3300010296 | Freshwater To Marine Saline Gradient | MIKRQAIKYLGWALLCMGKPFTCVGNWFWKMHRKVLDWNK* |
| Ga0129351_12879072 | 3300010300 | Freshwater To Marine Saline Gradient | MIKRQAIKYLGWALLYMGKPFTCVGNCFWKMHRKVLDWNN* |
| Ga0114934_101225332 | 3300011013 | Deep Subsurface | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKLHRKVLDWNN* |
| Ga0163179_113620182 | 3300012953 | Seawater | MRKCAIKYLGWALLYMGKPFTKVGDWFWKKHRQVLDWND* |
| Ga0116834_10401953 | 3300013188 | Marine | MKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVLDWNK* |
| Ga0181381_10746982 | 3300017726 | Seawater | MTRTCIKYMGWALLYMGKPFTYIGNWFWRMHRTVLDWND |
| Ga0181433_11359701 | 3300017739 | Seawater | MKRTAIKYLGWALLYMSKPFTYIGNWFWKLHRKVLDWNN |
| Ga0181427_10648683 | 3300017745 | Seawater | MRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWNE |
| Ga0181392_10006481 | 3300017749 | Seawater | KEMRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWNK |
| Ga0181392_10239317 | 3300017749 | Seawater | MRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWN |
| Ga0181392_12080911 | 3300017749 | Seawater | KEMRKQAVKYFGWALLYMGKPFTAIGNWFWKKHRDVLDWNN |
| Ga0181392_12274743 | 3300017749 | Seawater | MKHNLNTYLGWGLLYMGKPFTRIGNWFWKKHKQVLSR |
| Ga0181405_11089771 | 3300017750 | Seawater | TCIKYMGWALLYMGKPFTCIGNWFWRMHRTVLDWND |
| Ga0181414_10593411 | 3300017759 | Seawater | MRKQAVKYFGWALLYIGKPFTAIGNWFWKKHRDVLDWNK |
| Ga0181413_10469742 | 3300017765 | Seawater | MRKKAVKYFGWALLYMGKPFTRIGNWFWKMHKRVLDWNDNARP |
| Ga0181425_12547872 | 3300017771 | Seawater | MKRTCIKYMGWALLYMGKPFTYIGNWFWRMHRTVLDWND |
| Ga0181386_12070763 | 3300017773 | Seawater | FGWALLYMGKPFTRIGNWFWKMHKRVLDWNDNARP |
| Ga0181565_100110235 | 3300017818 | Salt Marsh | MKRQAIKYLGWALLYMGKPFTCIGNWFWKLHRKVLDWNK |
| Ga0181552_102355133 | 3300017824 | Salt Marsh | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKVLDWNK |
| Ga0181607_106566762 | 3300017950 | Salt Marsh | LVKYLGWGLLNMGKPFTRIGNWFWKLHRKVLDWNNK |
| Ga0181590_105901833 | 3300017967 | Salt Marsh | MIKRQAIKYLGWALLYMGKPFTCIGNWFWKLHRKVLDWNK |
| Ga0181576_100125476 | 3300017985 | Salt Marsh | MLRKSDLKRLAIRYLGWGLLYMGRPFTHIGNWFWKKHKQVLDWND |
| Ga0181553_100375587 | 3300018416 | Salt Marsh | MIKCIKKEAIKYFGWALLWMGKPFTSIGNWFWKLHRKVLDWND |
| Ga0181563_103176291 | 3300018420 | Salt Marsh | MKRAAVRYLGWGLLYICKFFSAIANWFWKKHKRVLDWND |
| Ga0194021_10026851 | 3300019703 | Sediment | MIKRQAIKYLGWALLYMGKPFTCVGNWFWKMHRKV |
| Ga0181603_101515931 | 3300020174 | Salt Marsh | RKYSIRYLGWGLLYMGKPFTCVGNWFWKLHRTVLDWNK |
| Ga0181570_1002900510 | 3300020207 | Salt Marsh | MKRKAIKYLGWGLLYMGRPFTHIGNWFWKKHKQVLDWND |
| Ga0211678_104178411 | 3300020388 | Marine | MKKKAITYLGLTLLNIGKPFTKVGNWFWKKHKQVLDWND |
| Ga0211518_100030631 | 3300020440 | Marine | MMKRKLITYLGLGLLYMGKPFTSIGNWFWKKHKQVLDWND |
| Ga0211518_100377337 | 3300020440 | Marine | MIKRQAIKYLGWALLYMGKPFTCIGNWFWKLHKRVLDWNN |
| Ga0206682_100140989 | 3300021185 | Seawater | MDIKRKAITWLGLALLHCGKPFTEIGNWFWRKHREVLDMNDGS |
| Ga0213867_11395344 | 3300021335 | Seawater | RKQAVKYFGWALLYMGKPFTAIGDWFWKKHRDVLDWNDNARP |
| Ga0213864_105157341 | 3300021379 | Seawater | PTLVKYLAWGLLYVSKPFTCVGNYIWKLHRKVLDWNK |
| Ga0222717_103736691 | 3300021957 | Estuarine Water | EEVMKHNLNTYLGWGLLYMGKPFTRIGNWFWKKHKQVLSRND |
| Ga0222718_100271786 | 3300021958 | Estuarine Water | MVIDFSQEKKAAVKYLGWALLYMGKPFTAIGNWFWKLHRKVLDWNN |
| Ga0222718_100390646 | 3300021958 | Estuarine Water | MKLDISNEKKAVVKYLGWALLYMGKPFTAIGNWFWKLHRKVLDWNN |
| Ga0222718_101228362 | 3300021958 | Estuarine Water | MRKQAVKYFGWALLYMGKPFTCVGNWFWKMHKRVLDWNDNA |
| Ga0222719_102264151 | 3300021964 | Estuarine Water | KYFGWALLYMGKPFTCVGNWFWKMHKRVLDWNDNA |
| Ga0224906_10037287 | 3300022074 | Seawater | MIKRQAIKYLGWALLYMGKPFTRIGNWFWKMHKRVLDWNDNA |
| Ga0224906_10351444 | 3300022074 | Seawater | MRKQAVKYFGWALLYMGKPFTAIGNWFWKKHKRVLDWNDNA |
| Ga0255769_103205803 | 3300022927 | Salt Marsh | HVRKYSIRYLGWGLLYMGKPFTCVGNWFWKLHRTVLDWNK |
| Ga0209992_103209083 | 3300024344 | Deep Subsurface | MKKCAIKYLGWALLYVGKPFTKVGNWFWKKHKQVLDWN |
| Ga0208667_10102651 | 3300025070 | Marine | IAHLGLGLLYMGKPFTCVGNWFWRMHRTVLDWNDK |
| Ga0208298_10018846 | 3300025084 | Marine | MRKQAVKYFGWALLYMGKPFTRVGNWFWKMHKRVLDWNDNA |
| Ga0209138_101394610 | 3300025617 | Marine | MKRKAITYLGWGLLYVGRPFTCIGNWFWKKHKQVLDWNDK |
| Ga0208428_101045211 | 3300025653 | Aqueous | NTKLKAIGVRYLGWGLLYMGKPFTRIGNWFWKLHRKVLDWNK |
| Ga0209505_11640701 | 3300025690 | Pelagic Marine | MIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLD |
| Ga0209305_11764591 | 3300025712 | Pelagic Marine | WWDGEKEMIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK |
| Ga0208150_12223653 | 3300025751 | Aqueous | VKYFGWGLLYMGKPFTAVGNWFWKRHRDVLDWGNK |
| Ga0209193_10168873 | 3300025816 | Pelagic Marine | MIKCIKKEAIKYLGWALLWMGKPFTSIGNWFWKLHRKVLDWNK |
| Ga0209714_10783241 | 3300025822 | Pelagic Marine | MIKCIKKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK |
| Ga0209832_12238951 | 3300025830 | Pelagic Marine | KKEAIKYLGWVLLWMGKPFTSIGNWFWKLHRKVLDWNK |
| Ga0209603_10738514 | 3300025849 | Pelagic Marine | KEEMRKQAVKYFGWALLYMGKPFTAIGNWFWKMHKRVLDWNDNARP |
| Ga0209929_10778001 | 3300026187 | Pond Water | KMKRKAITYLGWGLLYMGRPFTCIGNWFWKKHKQVLDWND |
| Ga0183755_100035213 | 3300029448 | Marine | MRKCAIKYLGWALLYMGRPFTKVGDWFWKKHRQVLDWND |
| Ga0183755_10397515 | 3300029448 | Marine | KRKLITKFGYLLLYMGKPFTAIGNWFWKMHRKVLDWNN |
| Ga0316201_112390462 | 3300032136 | Worm Burrow | MKRQAIKYLGWALLYMGKPFTCVGNWFWKKHRDVLDWNDK |
| Ga0316203_10063856 | 3300032274 | Microbial Mat | MRKQAVKYFGWALLYMGKPFTAIGNWFWKMHKRVLDWNDNARP |
| ⦗Top⦘ |