


| Basic Information | |
|---|---|
| Family ID | F093529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 71.70 % |
| % of genes near scaffold ends (potentially truncated) | 13.21 % |
| % of genes from short scaffolds (< 2000 bps) | 68.87 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (40.566 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (36.792 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.491 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 7.55 |
| PF07068 | Gp23 | 5.66 |
| PF00127 | Copper-bind | 4.72 |
| PF00479 | G6PD_N | 2.83 |
| PF02781 | G6PD_C | 2.83 |
| PF04984 | Phage_sheath_1 | 1.89 |
| PF01050 | MannoseP_isomer | 1.89 |
| PF00124 | Photo_RC | 1.89 |
| PF02511 | Thy1 | 0.94 |
| PF06841 | Phage_T4_gp19 | 0.94 |
| PF04851 | ResIII | 0.94 |
| PF06206 | CpeT | 0.94 |
| PF16363 | GDP_Man_Dehyd | 0.94 |
| PF00111 | Fer2 | 0.94 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.94 |
| PF08534 | Redoxin | 0.94 |
| PF16861 | Carbam_trans_C | 0.94 |
| PF08443 | RimK | 0.94 |
| PF00565 | SNase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 5.66 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 1.89 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.51 % |
| Unclassified | root | N/A | 8.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10029038 | All Organisms → Viruses → Predicted Viral | 2604 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10043175 | All Organisms → Viruses → Predicted Viral | 2019 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10181730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 689 | Open in IMG/M |
| 3300001778|ACM18_1034905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 857 | Open in IMG/M |
| 3300001846|ACM22_1062313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300001955|GOS2237_1021060 | All Organisms → Viruses | 1657 | Open in IMG/M |
| 3300001960|GOS2230_1005877 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
| 3300002483|JGI25132J35274_1113536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 544 | Open in IMG/M |
| 3300003580|JGI26260J51721_1044925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 712 | Open in IMG/M |
| 3300005805|Ga0079957_1039883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2991 | Open in IMG/M |
| 3300006026|Ga0075478_10089548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 987 | Open in IMG/M |
| 3300006802|Ga0070749_10464308 | All Organisms → Viruses | 692 | Open in IMG/M |
| 3300006802|Ga0070749_10670267 | All Organisms → Viruses | 556 | Open in IMG/M |
| 3300006810|Ga0070754_10433451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 572 | Open in IMG/M |
| 3300006869|Ga0075477_10118954 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300006870|Ga0075479_10216634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 765 | Open in IMG/M |
| 3300007113|Ga0101666_1008942 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300007538|Ga0099851_1001116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 11397 | Open in IMG/M |
| 3300007538|Ga0099851_1039784 | All Organisms → Viruses → Predicted Viral | 1865 | Open in IMG/M |
| 3300007538|Ga0099851_1052719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1595 | Open in IMG/M |
| 3300007538|Ga0099851_1208241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 709 | Open in IMG/M |
| 3300007539|Ga0099849_1000782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 14776 | Open in IMG/M |
| 3300007539|Ga0099849_1023406 | All Organisms → Viruses → Predicted Viral | 2679 | Open in IMG/M |
| 3300007539|Ga0099849_1077802 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300007539|Ga0099849_1203746 | All Organisms → Viruses | 743 | Open in IMG/M |
| 3300007539|Ga0099849_1231062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 686 | Open in IMG/M |
| 3300007539|Ga0099849_1292628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 589 | Open in IMG/M |
| 3300007539|Ga0099849_1333180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 542 | Open in IMG/M |
| 3300007539|Ga0099849_1346132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 529 | Open in IMG/M |
| 3300007539|Ga0099849_1365515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 511 | Open in IMG/M |
| 3300007541|Ga0099848_1000065 | Not Available | 38839 | Open in IMG/M |
| 3300007541|Ga0099848_1066470 | All Organisms → Viruses | 1426 | Open in IMG/M |
| 3300007541|Ga0099848_1129982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 945 | Open in IMG/M |
| 3300007640|Ga0070751_1195526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 788 | Open in IMG/M |
| 3300007960|Ga0099850_1000092 | Not Available | 35495 | Open in IMG/M |
| 3300007960|Ga0099850_1218591 | All Organisms → Viruses | 744 | Open in IMG/M |
| 3300009000|Ga0102960_1012214 | All Organisms → Viruses → Predicted Viral | 3244 | Open in IMG/M |
| 3300009000|Ga0102960_1017595 | All Organisms → Viruses → Predicted Viral | 2687 | Open in IMG/M |
| 3300009327|Ga0103843_100360 | All Organisms → Viruses → Predicted Viral | 2068 | Open in IMG/M |
| 3300009338|Ga0103826_113423 | All Organisms → Viruses | 560 | Open in IMG/M |
| 3300009509|Ga0123573_10883268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 836 | Open in IMG/M |
| 3300010296|Ga0129348_1203883 | Not Available | 672 | Open in IMG/M |
| 3300010297|Ga0129345_1027344 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
| 3300010297|Ga0129345_1044860 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300010297|Ga0129345_1354902 | All Organisms → Viruses | 504 | Open in IMG/M |
| 3300010299|Ga0129342_1313743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 537 | Open in IMG/M |
| 3300010318|Ga0136656_1033527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1861 | Open in IMG/M |
| 3300010318|Ga0136656_1098765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1025 | Open in IMG/M |
| 3300010354|Ga0129333_10808209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 799 | Open in IMG/M |
| 3300010389|Ga0136549_10089422 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300010389|Ga0136549_10219550 | All Organisms → Viruses | 819 | Open in IMG/M |
| 3300010412|Ga0136852_10096022 | All Organisms → Viruses → Predicted Viral | 3046 | Open in IMG/M |
| 3300010412|Ga0136852_10272807 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
| 3300012520|Ga0129344_1107029 | Not Available | 862 | Open in IMG/M |
| 3300013188|Ga0116834_1115666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 571 | Open in IMG/M |
| 3300016771|Ga0182082_1124290 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300017818|Ga0181565_10092612 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
| 3300017949|Ga0181584_10317331 | All Organisms → Viruses | 993 | Open in IMG/M |
| 3300017949|Ga0181584_10324825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 979 | Open in IMG/M |
| 3300017952|Ga0181583_10611311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 655 | Open in IMG/M |
| 3300017956|Ga0181580_10000476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 29829 | Open in IMG/M |
| 3300017964|Ga0181589_10603719 | All Organisms → Viruses | 698 | Open in IMG/M |
| 3300017967|Ga0181590_10174402 | All Organisms → Viruses → Predicted Viral | 1630 | Open in IMG/M |
| 3300017967|Ga0181590_10447765 | Not Available | 909 | Open in IMG/M |
| 3300018049|Ga0181572_10424380 | All Organisms → Viruses | 828 | Open in IMG/M |
| 3300018421|Ga0181592_10365958 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300018421|Ga0181592_10402030 | All Organisms → Viruses | 967 | Open in IMG/M |
| 3300018424|Ga0181591_10326460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1163 | Open in IMG/M |
| 3300020204|Ga0194116_10191535 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300020239|Ga0211501_1001348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5387 | Open in IMG/M |
| 3300020403|Ga0211532_10087093 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300020439|Ga0211558_10002535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 9812 | Open in IMG/M |
| 3300020442|Ga0211559_10047271 | All Organisms → Viruses → Predicted Viral | 2122 | Open in IMG/M |
| 3300020442|Ga0211559_10201220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 941 | Open in IMG/M |
| 3300020442|Ga0211559_10206063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 928 | Open in IMG/M |
| 3300021335|Ga0213867_1009248 | All Organisms → Viruses → Predicted Viral | 4180 | Open in IMG/M |
| 3300021356|Ga0213858_10392918 | All Organisms → Viruses | 652 | Open in IMG/M |
| 3300021379|Ga0213864_10019343 | All Organisms → Viruses | 3093 | Open in IMG/M |
| 3300021389|Ga0213868_10664061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 536 | Open in IMG/M |
| 3300021958|Ga0222718_10327120 | Not Available | 787 | Open in IMG/M |
| 3300021959|Ga0222716_10022252 | All Organisms → Viruses → Predicted Viral | 4699 | Open in IMG/M |
| 3300021959|Ga0222716_10047150 | All Organisms → Viruses → Predicted Viral | 3066 | Open in IMG/M |
| 3300021959|Ga0222716_10460646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 724 | Open in IMG/M |
| 3300021960|Ga0222715_10036609 | All Organisms → Viruses → Predicted Viral | 3485 | Open in IMG/M |
| 3300021960|Ga0222715_10038647 | All Organisms → Viruses → Predicted Viral | 3374 | Open in IMG/M |
| 3300021960|Ga0222715_10532499 | All Organisms → Viruses | 618 | Open in IMG/M |
| 3300021960|Ga0222715_10617643 | All Organisms → Viruses | 557 | Open in IMG/M |
| 3300022198|Ga0196905_1000050 | Not Available | 40460 | Open in IMG/M |
| 3300022198|Ga0196905_1033757 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300022200|Ga0196901_1002778 | All Organisms → Viruses | 8290 | Open in IMG/M |
| 3300022200|Ga0196901_1031452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2068 | Open in IMG/M |
| 3300022200|Ga0196901_1056744 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300024346|Ga0244775_11295448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300025483|Ga0209557_1000085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 60514 | Open in IMG/M |
| 3300025646|Ga0208161_1000113 | Not Available | 40945 | Open in IMG/M |
| 3300025647|Ga0208160_1070151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 957 | Open in IMG/M |
| 3300025674|Ga0208162_1000044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 57332 | Open in IMG/M |
| 3300025674|Ga0208162_1021277 | All Organisms → Viruses → Predicted Viral | 2495 | Open in IMG/M |
| 3300025674|Ga0208162_1029872 | All Organisms → Viruses → Predicted Viral | 2005 | Open in IMG/M |
| 3300025674|Ga0208162_1198781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 511 | Open in IMG/M |
| 3300025815|Ga0208785_1135282 | Not Available | 577 | Open in IMG/M |
| 3300025828|Ga0208547_1028359 | All Organisms → Viruses → Predicted Viral | 2155 | Open in IMG/M |
| 3300026138|Ga0209951_1075463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Bellamyvirus sp. | 705 | Open in IMG/M |
| 3300027917|Ga0209536_101190332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 935 | Open in IMG/M |
| 3300027917|Ga0209536_101631313 | All Organisms → Viruses | 782 | Open in IMG/M |
| 3300027917|Ga0209536_101830471 | All Organisms → Viruses | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 36.79% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 12.26% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.55% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.66% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.83% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.83% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 2.83% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.89% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.89% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.94% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.94% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009327 | Microbial communities of water from the North Atlantic ocean - ACM30 | Environmental | Open in IMG/M |
| 3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100290386 | 3300000116 | Marine | MNDEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI* |
| DelMOSpr2010_100431752 | 3300000116 | Marine | MNEEEIIFTDRDEELLRQAMRFLKHRELLNEPFDGYWEDDDDI* |
| DelMOSpr2010_101817302 | 3300000116 | Marine | MNEEEKSTFTEEDEKLLRQAMKFLKNRELMEEPFDGYWEDEDDI* |
| ACM18_10349052 | 3300001778 | Marine Plankton | MNTEGEKFTEEDERLLRQAMNFLKHRELLQEPFDGYWQDEDDV* |
| ACM22_10623133 | 3300001846 | Marine Plankton | MNEEEIIFTERDEELLRQAMRFIKHRELLNEPFDGYWEDEDDI* |
| GOS2237_10210603 | 3300001955 | Marine | MDRKSEDKFTEEDEKLLQQAVRFLKHREMCQEPFDGYWEDDDDV* |
| GOS2230_10058774 | 3300001960 | Marine | MDRKSEDKFTEDDEKLLQQAIRFLKHRELCQEPFDGYWQDDDDV* |
| JGI25132J35274_11135362 | 3300002483 | Marine | MDRKSEDKFTEEDEKLLQQAVRFLKHREMCQEPFDGYWEDGDDV* |
| JGI26260J51721_10449251 | 3300003580 | Marine | GLRHMNEGDQEAKFTKEDEQLLRQAMAFLKHRELCQEPFDGYWEDGDDI* |
| Ga0079957_10398836 | 3300005805 | Lake | MNSEEQFTEEDEKLLRQAMRFLKHRELLQEPFDGYWEEDDDV* |
| Ga0075478_100895481 | 3300006026 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI* |
| Ga0070749_104643082 | 3300006802 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELMEEPFDGYWQDDDDI* |
| Ga0070749_106702672 | 3300006802 | Aqueous | MNEEEKSTFTEEDEKLLRQAMRFLKNRELMEEPFEGYWEDEDDV* |
| Ga0070754_104334513 | 3300006810 | Aqueous | RRFVQRQMNEEEIVFTERDEELLRQAMRFLKHRELLKEPFDGYWEDDDDI* |
| Ga0075477_101189541 | 3300006869 | Aqueous | DRDEELLRQAMRFLKHRELLNEPFDGYWEDDDDI* |
| Ga0075479_102166342 | 3300006870 | Aqueous | EEEIIFTEKDEELLRQAMRFLKHRELMEEPFDGYWQDDDDI* |
| Ga0101666_10089425 | 3300007113 | Volcanic Co2 Seep Seawater | MEDQVKFTEEDEQKLRQAMQFLKHREMCQEPFDGYWEDDDDI* |
| Ga0099851_100111614 | 3300007538 | Aqueous | MNEEQIIFTDRDEELLRQAMRFLKHRELLNEPFDGYWEDEDDI* |
| Ga0099851_10397843 | 3300007538 | Aqueous | EGQMNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWQDEDDI* |
| Ga0099851_10527195 | 3300007538 | Aqueous | MNDEETIFTEKDEELLRQAMRFLKHRELMEEPFDGYWEDDDDI* |
| Ga0099851_12082411 | 3300007538 | Aqueous | MEEEDLKFTEKDERLLRQAMNFLKHRELMQEPFDGYWQDEDDV* |
| Ga0099849_100078221 | 3300007539 | Aqueous | MKEEDKEKFTDEDERLLRQAMMFLKHRELCEEPFDGYWEDDDDI* |
| Ga0099849_10234068 | 3300007539 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLQEPFDGYWEDEDDI* |
| Ga0099849_10778021 | 3300007539 | Aqueous | GTVEGQMNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDEDDV* |
| Ga0099849_12037463 | 3300007539 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELMEEPFDGYWQDNDDI* |
| Ga0099849_12310622 | 3300007539 | Aqueous | MEEEDLKFTEEDERLLRQAMNFLKHRELMQEPFDGYWQDEDDV* |
| Ga0099849_12926282 | 3300007539 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWQDEDDI* |
| Ga0099849_13331801 | 3300007539 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI* |
| Ga0099849_13461323 | 3300007539 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELMEEPFDGYWQDDDDI* |
| Ga0099849_13655152 | 3300007539 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELLSEPFDGYWEDDDDI* |
| Ga0099848_10000654 | 3300007541 | Aqueous | MEEETIFTEKDEELLRQAMRFLKHRELLQEPFDGYWENDNDV* |
| Ga0099848_10664706 | 3300007541 | Aqueous | MNEEEVIFTERDEQLLRQAMRFLKHRELLQEPFDGYWEEDDDV* |
| Ga0099848_11299823 | 3300007541 | Aqueous | MNSEEQFTDEDEKLLRQAMRFLKHRELLQEPFDGYWEEDDDV* |
| Ga0070751_11955263 | 3300007640 | Aqueous | NEEEIIFTDRDEELLRQAMRFLKHRELLNEPFDGYWEDDDDI* |
| Ga0099850_100009236 | 3300007960 | Aqueous | MEEETIFTEKDEELLRQAMRFLKHRELLQEPFDGYWENDNDI* |
| Ga0099850_12185913 | 3300007960 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLDEPFDGYWQDEDDI* |
| Ga0102960_10122145 | 3300009000 | Pond Water | MNEEEIVFTERDEELLRQAMRFLKHRELLKEPFDGYWEDDDDI* |
| Ga0102960_10175955 | 3300009000 | Pond Water | MNEEEIVFTDRDEELLRQAMRFIKHRELLNEPFDGYWEDDDDI* |
| Ga0103843_1003604 | 3300009327 | River Water | MNDDNNTEQFTEEDEKLLRQAMQFIKHRELCQEPFDGYWEDDDDV* |
| Ga0103826_1134232 | 3300009338 | River Water | MNDEEIVFTDRDEELLRQAMRFLKHRELLEEPFDGYWEDEDDI* |
| Ga0123573_108832683 | 3300009509 | Mangrove Sediment | MEEDIIFTEQDEELLRQAMRFLKHRELLQEPFDGYWEDEDDV* |
| Ga0129348_12038832 | 3300010296 | Freshwater To Marine Saline Gradient | MNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDEDDV* |
| Ga0129345_10273445 | 3300010297 | Freshwater To Marine Saline Gradient | MNEEQIIFTDRDEELLRQAMRFLKHRELLNEPFDGYLEDEDDI* |
| Ga0129345_10448602 | 3300010297 | Freshwater To Marine Saline Gradient | MNEEEIIFTDRDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI* |
| Ga0129345_13549022 | 3300010297 | Freshwater To Marine Saline Gradient | MNEEEIIFTERDEELLRQAMRFVKHRELLNEPFDGYWEDEDDI* |
| Ga0129342_13137432 | 3300010299 | Freshwater To Marine Saline Gradient | MNEEEIIFTERDEELLRQAMRFLKHRELMEEPFDGYWEDDDDT* |
| Ga0136656_10335276 | 3300010318 | Freshwater To Marine Saline Gradient | MEEEDLKFTEEDERLLRQAMNFLKHRELMQEPFDGYWQ |
| Ga0136656_10987654 | 3300010318 | Freshwater To Marine Saline Gradient | MKEDGEEKFTEEDEKLLRQAMRFIKNRELMEEPCYWEDDDDL* |
| Ga0129333_108082093 | 3300010354 | Freshwater To Marine Saline Gradient | MNDEQIVFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI* |
| Ga0136549_100894225 | 3300010389 | Marine Methane Seep Sediment | MKEEKNIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDEDDV* |
| Ga0136549_102195502 | 3300010389 | Marine Methane Seep Sediment | MNEEEKSTFTEEDEKLLRQAMRFLKNRELMEEPFDGYWEDEDDI* |
| Ga0136852_100960221 | 3300010412 | Mangrove Sediment | MNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI* |
| Ga0136852_102728072 | 3300010412 | Mangrove Sediment | MNTEGEKFTEEDEMLLRQAMKFLKHRELLQEPYDGYWQDEDDV* |
| Ga0129344_11070295 | 3300012520 | Aqueous | MKEEDKEKFTDEDERLLRQAMMFLKHRELCEEPFDGYWEDD |
| Ga0116834_11156662 | 3300013188 | Marine | MEQEEKFTEEDERLLRQAMNFLKHRELMQEPFDGYWEDDDDI* |
| Ga0182082_11242901 | 3300016771 | Salt Marsh | NENEDKEHFTDEDEKLLRQAMQFIKHRELCQEPFDGYWEDDDDV |
| Ga0181565_100926122 | 3300017818 | Salt Marsh | MNDEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI |
| Ga0181584_103173312 | 3300017949 | Salt Marsh | MNENEDKEHFTDEDEKLLRQAMQFIKHRELCQEPFDGYWEDDDDV |
| Ga0181584_103248252 | 3300017949 | Salt Marsh | MNDEEIIFTDTDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI |
| Ga0181583_106113112 | 3300017952 | Salt Marsh | MSDEETIFTEKDEELLRQAMRFLKHRELMEEPFDGYWEDDDDI |
| Ga0181580_1000047645 | 3300017956 | Salt Marsh | MSEEPKEKFTEEDEKLLHQAVRFLKHRELCQEPFDGYWEDDDDV |
| Ga0181589_106037192 | 3300017964 | Salt Marsh | MNEEEIIFTEKDEELLRQAMRFLKHRELMEEPFDGYWQDDDDI |
| Ga0181590_101744023 | 3300017967 | Salt Marsh | MEEEDLKFTEEDERLLRQAMNFLKHRELMQEPFDGYWQDEDDV |
| Ga0181590_104477651 | 3300017967 | Salt Marsh | MDRKSEDKFTEEDEKLLQQAVRFLKHREMCQEPFDGYWEDGDDV |
| Ga0181572_104243803 | 3300018049 | Salt Marsh | GTIKGQMNDEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI |
| Ga0181592_103659584 | 3300018421 | Salt Marsh | MNEGDQESKFTEEDEQLLRQAMAFLKHRELCQEPFDGYWEDDDDV |
| Ga0181592_104020304 | 3300018421 | Salt Marsh | MKEEKNIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDEDDV |
| Ga0181591_103264601 | 3300018424 | Salt Marsh | MNDEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWED |
| Ga0194116_101915352 | 3300020204 | Freshwater Lake | MEEETIFTERDEELLRQAMRFIKNRELMEEPSYWEDEDDI |
| Ga0211501_100134810 | 3300020239 | Marine | MEDQVKFTEEDEQKLRQAMQFLKHREMCQEPFDGYWEDDDDV |
| Ga0211532_100870934 | 3300020403 | Marine | MEDQVKFTEEDEQKLRQAMQFLKHREMCQEPFDGYWEDDDDI |
| Ga0211558_100025354 | 3300020439 | Marine | MEDQVKFTEEDEQKLRQAMQFIKHREMCQEPFDGYWEDDDDI |
| Ga0211559_100472715 | 3300020442 | Marine | MDRKSEDKFTEEDEKLLQQAVRFLKHREMCQEPFDGYWEDDDDV |
| Ga0211559_102012203 | 3300020442 | Marine | MDRKSEDKFTEDDEKLLQQAIRFLKHRELCQEPFDGYWQDDDDV |
| Ga0211559_102060632 | 3300020442 | Marine | MSQEDQESKFTDEDEHLLRQAMKFLKQRELCQEPFDGFWEDDDDV |
| Ga0213867_10092484 | 3300021335 | Seawater | MNDEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDV |
| Ga0213858_103929181 | 3300021356 | Seawater | MEQEEKFTEEDERLLRQAMNFLKHRELMQEPFDGYWEDDDDI |
| Ga0213864_100193435 | 3300021379 | Seawater | MNEEEKSTFTEEDEKLLRQAMRFLKNRELMEEPFEGYWEDEDDV |
| Ga0213868_106640613 | 3300021389 | Seawater | MNSEEQFTDEDEKLLRQAMRFLKHRELLQEPFDGYWEEDDDV |
| Ga0222718_103271202 | 3300021958 | Estuarine Water | MNEEEIVFTERDEELLRQAMRFLKHRELLKEPFDGYWEDDDDI |
| Ga0222716_100222522 | 3300021959 | Estuarine Water | MNEEDIIFTERDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI |
| Ga0222716_100471506 | 3300021959 | Estuarine Water | MNEEEIIFTDRDEELLRQAMRFLKHRELLSEPFDGYWEDDDDI |
| Ga0222716_104606461 | 3300021959 | Estuarine Water | MNEEDIIFTERDEELLRQAMRFLKHRELLKEPFDGYWEDDDDI |
| Ga0222715_100366096 | 3300021960 | Estuarine Water | MKEEDKEKFTEEDERLLRQAMMFLKHRELCEEPFDGYWEDEDDI |
| Ga0222715_100386478 | 3300021960 | Estuarine Water | MEEEDLKFTEEDERLLRQAMNFLKHRDLMQEPFDGYWQDEDDV |
| Ga0222715_105324992 | 3300021960 | Estuarine Water | MNEEEIIFTERDEELLRQAMRFIKHRELLNEPFDGYWEDEDDI |
| Ga0222715_106176432 | 3300021960 | Estuarine Water | MNEEEKSTFTEEDEKLLRQAMKFLKNRELMEEPFDGYWEDEDDI |
| Ga0196905_10000508 | 3300022198 | Aqueous | MEEETIFTEKDEELLRQAMRFLKHRELLQEPFDGYWENDNDI |
| Ga0196905_10337575 | 3300022198 | Aqueous | MNDEETIFTEKDEELLRQAMRFLKHRELMEEPFDGYWEDDDDI |
| Ga0196901_10027786 | 3300022200 | Aqueous | MNEEQIIFTDRDEELLRQAMRFLKHRELLNEPFDGYWEDEDDI |
| Ga0196901_10314522 | 3300022200 | Aqueous | MEEEDLKFTEKDERLLRQAMNFLKHRELMQEPFDGYWQDEDDV |
| Ga0196901_10567442 | 3300022200 | Aqueous | MNDEQIVFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDDDDI |
| Ga0244775_112954483 | 3300024346 | Estuarine | MNEEEIIFTERDEDLLRQAMRFLKHRELMEEPFDGYWEDDDDT |
| Ga0209557_100008512 | 3300025483 | Marine | MNEGDQEAKFTKEDEQLLRQAMAFLKHRELCQEPFDGYWEDGDDI |
| Ga0208161_100011336 | 3300025646 | Aqueous | MEEETIFTEKDEELLRQAMRFLKHRELLQEPFDGYWENDNDV |
| Ga0208160_10701512 | 3300025647 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELMEEPFDGYWQDDDDI |
| Ga0208162_100004410 | 3300025674 | Aqueous | MKEEDKEKFTDEDERLLRQAMMFLKHRELCEEPFDGYWEDDDDI |
| Ga0208162_10212774 | 3300025674 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLEEPFDGYWEDEDDV |
| Ga0208162_10298722 | 3300025674 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLQEPFDGYWEDEDDI |
| Ga0208162_11987811 | 3300025674 | Aqueous | MNEEEIIFTEKDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI |
| Ga0208785_11352822 | 3300025815 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELLKEPFDGYWEDEDDI |
| Ga0208547_10283592 | 3300025828 | Aqueous | MNEEEIIFTDRDEELLRQAMRFLKHRELLNEPFDGYWEDDDDI |
| Ga0209951_10754632 | 3300026138 | Pond Water | MNEEEIVFTDRDEELLRQAMRFIKHRELLNEPFDGYWEDDDDI |
| Ga0209536_1011903324 | 3300027917 | Marine Sediment | MNEEEKSTFTEEDEKLLRQAMRFLKNRELMEEPFDGYWEDEDDI |
| Ga0209536_1016313132 | 3300027917 | Marine Sediment | MNEEEVIFTERDEQLLRQAMRFLKHRELLQEPFDGYWEEDDDV |
| Ga0209536_1018304713 | 3300027917 | Marine Sediment | MNEEEIIFTEKDEELLRQAMRFLKHRELLDEPFDGYWQDEDDI |
| ⦗Top⦘ |