


| Basic Information | |
|---|---|
| Family ID | F093459 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.09 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.075 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.792 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.755 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 2.17% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF04879 | Molybdop_Fe4S4 | 5.66 |
| PF01738 | DLH | 5.66 |
| PF13376 | OmdA | 4.72 |
| PF07519 | Tannase | 4.72 |
| PF13637 | Ank_4 | 3.77 |
| PF05726 | Pirin_C | 2.83 |
| PF08843 | AbiEii | 1.89 |
| PF03551 | PadR | 1.89 |
| PF12796 | Ank_2 | 1.89 |
| PF02900 | LigB | 1.89 |
| PF13744 | HTH_37 | 1.89 |
| PF00160 | Pro_isomerase | 1.89 |
| PF01053 | Cys_Met_Meta_PP | 1.89 |
| PF01568 | Molydop_binding | 1.89 |
| PF00106 | adh_short | 0.94 |
| PF00196 | GerE | 0.94 |
| PF13432 | TPR_16 | 0.94 |
| PF00775 | Dioxygenase_C | 0.94 |
| PF12695 | Abhydrolase_5 | 0.94 |
| PF12680 | SnoaL_2 | 0.94 |
| PF12625 | Arabinose_bd | 0.94 |
| PF02922 | CBM_48 | 0.94 |
| PF07681 | DoxX | 0.94 |
| PF08486 | SpoIID | 0.94 |
| PF01522 | Polysacc_deac_1 | 0.94 |
| PF13620 | CarboxypepD_reg | 0.94 |
| PF00135 | COesterase | 0.94 |
| PF08327 | AHSA1 | 0.94 |
| PF01565 | FAD_binding_4 | 0.94 |
| PF13361 | UvrD_C | 0.94 |
| PF01769 | MgtE | 0.94 |
| PF07676 | PD40 | 0.94 |
| PF14534 | DUF4440 | 0.94 |
| PF12704 | MacB_PCD | 0.94 |
| PF15902 | Sortilin-Vps10 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 2.83 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.89 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.89 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.89 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.89 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.89 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 1.89 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.89 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.89 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.89 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.89 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.89 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.89 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.89 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.89 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.94 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.94 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.08 % |
| Unclassified | root | N/A | 17.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002459|JGI24751J29686_10109609 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005093|Ga0062594_100045144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2197 | Open in IMG/M |
| 3300005171|Ga0066677_10548183 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005289|Ga0065704_10431473 | Not Available | 722 | Open in IMG/M |
| 3300005295|Ga0065707_10338760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300005295|Ga0065707_10559230 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005330|Ga0070690_100055492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2537 | Open in IMG/M |
| 3300005331|Ga0070670_100614442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
| 3300005331|Ga0070670_102046410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005332|Ga0066388_101877151 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005343|Ga0070687_100125409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1475 | Open in IMG/M |
| 3300005356|Ga0070674_101087490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 705 | Open in IMG/M |
| 3300005365|Ga0070688_100426527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 987 | Open in IMG/M |
| 3300005444|Ga0070694_101838335 | Not Available | 516 | Open in IMG/M |
| 3300005467|Ga0070706_100631500 | Not Available | 994 | Open in IMG/M |
| 3300005518|Ga0070699_100543130 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005544|Ga0070686_100821779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 750 | Open in IMG/M |
| 3300005549|Ga0070704_100116567 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300005578|Ga0068854_102003386 | Not Available | 533 | Open in IMG/M |
| 3300005617|Ga0068859_100271062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1790 | Open in IMG/M |
| 3300005719|Ga0068861_100024237 | All Organisms → cellular organisms → Bacteria | 4387 | Open in IMG/M |
| 3300005719|Ga0068861_101981864 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005719|Ga0068861_102094885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300005840|Ga0068870_10051410 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300005842|Ga0068858_100790653 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005843|Ga0068860_100283240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
| 3300006844|Ga0075428_100987616 | Not Available | 891 | Open in IMG/M |
| 3300006845|Ga0075421_101467473 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300006847|Ga0075431_100051570 | All Organisms → cellular organisms → Bacteria | 4242 | Open in IMG/M |
| 3300006847|Ga0075431_100855525 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300006852|Ga0075433_10378686 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300006880|Ga0075429_101943794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300006969|Ga0075419_10793515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300009094|Ga0111539_10747704 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300009094|Ga0111539_10906350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300009094|Ga0111539_11488311 | Not Available | 785 | Open in IMG/M |
| 3300009094|Ga0111539_11890225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300009094|Ga0111539_12660489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 580 | Open in IMG/M |
| 3300009098|Ga0105245_12463816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300009100|Ga0075418_10351465 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300009100|Ga0075418_10655695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1131 | Open in IMG/M |
| 3300009101|Ga0105247_10809276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 716 | Open in IMG/M |
| 3300009147|Ga0114129_10022629 | All Organisms → cellular organisms → Bacteria | 8914 | Open in IMG/M |
| 3300009147|Ga0114129_13154526 | Not Available | 537 | Open in IMG/M |
| 3300009148|Ga0105243_10750894 | Not Available | 956 | Open in IMG/M |
| 3300009156|Ga0111538_11339969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 903 | Open in IMG/M |
| 3300009176|Ga0105242_10251151 | Not Available | 1594 | Open in IMG/M |
| 3300009176|Ga0105242_12813248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300009177|Ga0105248_11471640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300009177|Ga0105248_11934462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 669 | Open in IMG/M |
| 3300009177|Ga0105248_13368418 | Not Available | 508 | Open in IMG/M |
| 3300009527|Ga0114942_1292270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 622 | Open in IMG/M |
| 3300010041|Ga0126312_11343699 | Not Available | 529 | Open in IMG/M |
| 3300010043|Ga0126380_10400584 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300010362|Ga0126377_13527792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300010400|Ga0134122_11801854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300010400|Ga0134122_13146115 | Not Available | 516 | Open in IMG/M |
| 3300011119|Ga0105246_11984796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 561 | Open in IMG/M |
| 3300012891|Ga0157305_10183591 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012914|Ga0157297_10491284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300012927|Ga0137416_10818172 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300013306|Ga0163162_12346560 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → unclassified Leptospiraceae → Leptospiraceae bacterium | 613 | Open in IMG/M |
| 3300014157|Ga0134078_10296240 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300014325|Ga0163163_10986052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 906 | Open in IMG/M |
| 3300014326|Ga0157380_10786224 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300014968|Ga0157379_12236996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300015371|Ga0132258_10263885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4216 | Open in IMG/M |
| 3300015372|Ga0132256_101175423 | Not Available | 881 | Open in IMG/M |
| 3300015372|Ga0132256_102974137 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300015373|Ga0132257_103575516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300015374|Ga0132255_101775344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300015374|Ga0132255_103605060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300018000|Ga0184604_10165406 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018000|Ga0184604_10172352 | Not Available | 726 | Open in IMG/M |
| 3300018028|Ga0184608_10525542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300018067|Ga0184611_1349588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300018429|Ga0190272_12473605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300018433|Ga0066667_11373281 | Not Available | 619 | Open in IMG/M |
| 3300019356|Ga0173481_10675664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300021080|Ga0210382_10117334 | Not Available | 1121 | Open in IMG/M |
| 3300021178|Ga0210408_10357207 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300025905|Ga0207685_10778700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300025908|Ga0207643_10046132 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300025918|Ga0207662_10020350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3786 | Open in IMG/M |
| 3300025927|Ga0207687_11017374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300025934|Ga0207686_11321844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300025937|Ga0207669_11917808 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025940|Ga0207691_10191871 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300025960|Ga0207651_10062662 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300025960|Ga0207651_10675564 | Not Available | 908 | Open in IMG/M |
| 3300026035|Ga0207703_10389456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300026088|Ga0207641_10670570 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300026118|Ga0207675_101707645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300026369|Ga0257152_1025451 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026499|Ga0257181_1044907 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027907|Ga0207428_10786961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300027909|Ga0209382_11565422 | Not Available | 653 | Open in IMG/M |
| 3300028881|Ga0307277_10368878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300031716|Ga0310813_11083912 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031720|Ga0307469_10129625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1843 | Open in IMG/M |
| 3300031940|Ga0310901_10140424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300032003|Ga0310897_10708614 | Not Available | 505 | Open in IMG/M |
| 3300032075|Ga0310890_10180381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1429 | Open in IMG/M |
| 3300032122|Ga0310895_10138841 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300032174|Ga0307470_10613049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300033412|Ga0310810_11149022 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24751J29686_101096092 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYTAHNGRSMTANRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA |
| Ga0062594_1000451443 | 3300005093 | Soil | MTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0066677_105481831 | 3300005171 | Soil | MTAKRSRKRVASVREYIASKPKESRSSLEAVRRAILKALPNAQEGLA |
| Ga0065704_104314731 | 3300005289 | Switchgrass Rhizosphere | MTAKRSRKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQM |
| Ga0065707_103387603 | 3300005295 | Switchgrass Rhizosphere | MTAKRSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN |
| Ga0065707_105592303 | 3300005295 | Switchgrass Rhizosphere | MTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0070690_1000554925 | 3300005330 | Switchgrass Rhizosphere | MTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNA |
| Ga0070670_1006144421 | 3300005331 | Switchgrass Rhizosphere | MTAKRSRKRVASVPEYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN |
| Ga0070670_1020464101 | 3300005331 | Switchgrass Rhizosphere | MAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPV |
| Ga0066388_1018771511 | 3300005332 | Tropical Forest Soil | VIMAKTAKKRVNSVREYIASQPKESRASLEAVRRAILGAIPT |
| Ga0070687_1001254091 | 3300005343 | Switchgrass Rhizosphere | MAMSVSNVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN |
| Ga0070674_1010874902 | 3300005356 | Miscanthus Rhizosphere | MTAKRSRKRVALVREYLASKPKESRASLEAVRRAILKALPN |
| Ga0070688_1004265271 | 3300005365 | Switchgrass Rhizosphere | MTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0070694_1018383351 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP |
| Ga0070706_1006315001 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAKRSRNRVASVREYVASKPKESRASLEAVRRAILKALP |
| Ga0070699_1005431301 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPDV |
| Ga0070686_1008217792 | 3300005544 | Switchgrass Rhizosphere | MTAKRSRKRVGSVREYVASKPKEARASLEAVRRAILKALPNAQEGLAYQMPAYTL |
| Ga0070704_1001165671 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEG |
| Ga0068854_1020033862 | 3300005578 | Corn Rhizosphere | MTAKRPRKRVASVREYVASKPKESRASLEAVRRAILK |
| Ga0068859_1002710621 | 3300005617 | Switchgrass Rhizosphere | MKYTAHNGRSMTANRFRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQE |
| Ga0068861_1000242375 | 3300005719 | Switchgrass Rhizosphere | MAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEGLAYQMPA |
| Ga0068861_1019818642 | 3300005719 | Switchgrass Rhizosphere | MTAKRSRKRLASVREYIASKPKECRSSLEAVRRAILKALPNAQEGLAY |
| Ga0068861_1020948851 | 3300005719 | Switchgrass Rhizosphere | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0068870_100514101 | 3300005840 | Miscanthus Rhizosphere | MATSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0068858_1007906531 | 3300005842 | Switchgrass Rhizosphere | MTAKWSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA |
| Ga0068860_1002832401 | 3300005843 | Switchgrass Rhizosphere | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0075428_1009876162 | 3300006844 | Populus Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKAL |
| Ga0075421_1014674732 | 3300006845 | Populus Rhizosphere | MSAKRSRKRVASVREYVASKPKDSRASLEAVRRAILKALPNAQEGLA |
| Ga0075431_1000515701 | 3300006847 | Populus Rhizosphere | MTAKRSRKRFASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQ |
| Ga0075431_1008555252 | 3300006847 | Populus Rhizosphere | VRSMTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0075433_103786863 | 3300006852 | Populus Rhizosphere | MTAKRSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY |
| Ga0075429_1019437941 | 3300006880 | Populus Rhizosphere | VRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY |
| Ga0075419_107935151 | 3300006969 | Populus Rhizosphere | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMP |
| Ga0111539_107477042 | 3300009094 | Populus Rhizosphere | MRSMTVKRSRKRVASVREYVASKPKESRASLEAVRR |
| Ga0111539_109063501 | 3300009094 | Populus Rhizosphere | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKA |
| Ga0111539_114883112 | 3300009094 | Populus Rhizosphere | MKYTAHNGRSMTANRSRKRVASVREYVASKPKESRASLEAVRRAILKAL |
| Ga0111539_118902251 | 3300009094 | Populus Rhizosphere | MTAKRPRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYT |
| Ga0111539_126604891 | 3300009094 | Populus Rhizosphere | MTAKQSRKRVASVREYVASKPKESRASLEAVRRAILKALP |
| Ga0105245_124638161 | 3300009098 | Miscanthus Rhizosphere | MTAKRSPGKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0075418_103514653 | 3300009100 | Populus Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0075418_106556954 | 3300009100 | Populus Rhizosphere | MTAKRSRERVASVREYVASKPKESRASLEAVRRAIL |
| Ga0105247_108092761 | 3300009101 | Switchgrass Rhizosphere | MTAKRSRKRVASVREYVASKPKASRASLEAVRRAILKALPNAQEGLACQMPAYTLNGV |
| Ga0114129_100226291 | 3300009147 | Populus Rhizosphere | MVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTL |
| Ga0114129_131545262 | 3300009147 | Populus Rhizosphere | MMAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQE |
| Ga0105243_107508942 | 3300009148 | Miscanthus Rhizosphere | MSAKRSRKRVASVREYVASQPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0111538_113399691 | 3300009156 | Populus Rhizosphere | MTAKRSGKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0105242_102511511 | 3300009176 | Miscanthus Rhizosphere | MTAKRSKKRVGSVREYVASKPKEARASLEAVRRAILKALPNAQEGLAYQMPAYT |
| Ga0105242_128132482 | 3300009176 | Miscanthus Rhizosphere | MAAKRSRKRVASVREYVASKPKESRTSLEAVRRAILKALPNAQEGLAYQMP |
| Ga0105248_114716401 | 3300009177 | Switchgrass Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAI |
| Ga0105248_119344621 | 3300009177 | Switchgrass Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0105248_133684181 | 3300009177 | Switchgrass Rhizosphere | MTAKRYRKRVGSVREYVASKPKEARASLEAVRRAILKALP |
| Ga0114942_12922701 | 3300009527 | Groundwater | MAAKQPRRRVASVREYIASKPKESRASLEAVRRAILR |
| Ga0126312_113436991 | 3300010041 | Serpentine Soil | MTAKRSRRRVASVREYFASMPKESRTSLEAVRRAILKALPNAQE |
| Ga0126380_104005841 | 3300010043 | Tropical Forest Soil | MVKTAKKRVSPVREYIASKPKESRASLEAVRRAILETIPTVHEGLA |
| Ga0126377_135277922 | 3300010362 | Tropical Forest Soil | MKAKRSRKRVASVREYIASKPKESRARLEAVRRAILKALPNA |
| Ga0134122_118018541 | 3300010400 | Terrestrial Soil | MAAKQSRKRVGSVREYVASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0134122_131461151 | 3300010400 | Terrestrial Soil | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNA |
| Ga0105246_119847963 | 3300011119 | Miscanthus Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEG |
| Ga0157305_101835912 | 3300012891 | Soil | MTAKRSRKRVASVREYIASKPKESRASLEAVRRSILKALPNAEEGLAY |
| Ga0157297_104912842 | 3300012914 | Soil | MTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTL |
| Ga0137416_108181721 | 3300012927 | Vadose Zone Soil | MTAKRSRKRVASVREYLASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0163162_123465601 | 3300013306 | Switchgrass Rhizosphere | MTAKRSRTRVASVREYIASKPKASRASLEAVRRAILKAL |
| Ga0134078_102962401 | 3300014157 | Grasslands Soil | MTAKRSRKRVASVREYIASKPKESRASLDAVRRAILKALPNA |
| Ga0163163_109860521 | 3300014325 | Switchgrass Rhizosphere | MTAKRSPRKRVASVREYIASKPKESRASLEAVRRAILK |
| Ga0157380_107862244 | 3300014326 | Switchgrass Rhizosphere | MTVKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0157379_122369962 | 3300014968 | Switchgrass Rhizosphere | MSSMTAKRSRKRVTSVREYVASKPKESRASLEAVRRAILKALPNAQE |
| Ga0132258_102638856 | 3300015371 | Arabidopsis Rhizosphere | MTAKRSRKRLASVREYVASKPKESRASLEAVRRAILKALPNAQ |
| Ga0132256_1011754232 | 3300015372 | Arabidopsis Rhizosphere | MTAKRSRKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQMPAYTLNG |
| Ga0132256_1029741371 | 3300015372 | Arabidopsis Rhizosphere | MTAKRSRKRIASVREYVASKPKESRASLEAVRRAILKAISNAQEGLAYQMPAYTLNGVGV |
| Ga0132257_1035755161 | 3300015373 | Arabidopsis Rhizosphere | MRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0132255_1017753442 | 3300015374 | Arabidopsis Rhizosphere | MRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPKAQEGLAYQMPAYTL |
| Ga0132255_1036050602 | 3300015374 | Arabidopsis Rhizosphere | MTAKRSGKRVASVREYVASKPKESRGSLEAVRRAILKALPNAQEGLAYQMPAYTLNGVG |
| Ga0184604_101654063 | 3300018000 | Groundwater Sediment | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAIL |
| Ga0184604_101723521 | 3300018000 | Groundwater Sediment | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAI |
| Ga0184608_105255422 | 3300018028 | Groundwater Sediment | MTAKRSRKRVASVREYGASKPKESRASLEAVRRAILKALPNAQEGLAY |
| Ga0184611_13495882 | 3300018067 | Groundwater Sediment | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0190272_124736052 | 3300018429 | Soil | MTAKRARKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAY |
| Ga0066667_113732812 | 3300018433 | Grasslands Soil | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0173481_106756642 | 3300019356 | Soil | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILNALPNAQEGLAYQMPAYTLN |
| Ga0210382_101173341 | 3300021080 | Groundwater Sediment | MTAKRSRKRVASVRDYVASKPKESRASLEAVRRAILKALPDAQEG |
| Ga0210408_103572072 | 3300021178 | Soil | MAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP |
| Ga0207685_107787002 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0207643_100461322 | 3300025908 | Miscanthus Rhizosphere | MATSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKAIP |
| Ga0207662_100203504 | 3300025918 | Switchgrass Rhizosphere | MAMSVNNVRSMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILK |
| Ga0207687_110173742 | 3300025927 | Miscanthus Rhizosphere | MTAKRSRKRVASVREYIASKPKESRASLEAVRRAILKA |
| Ga0207686_113218442 | 3300025934 | Miscanthus Rhizosphere | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAY |
| Ga0207669_119178081 | 3300025937 | Miscanthus Rhizosphere | MTAKRSGKRVASVREYIASKPKESRASLEAVRRAILKALPTAQ |
| Ga0207691_101918711 | 3300025940 | Miscanthus Rhizosphere | MAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0207651_100626621 | 3300025960 | Switchgrass Rhizosphere | MTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPA |
| Ga0207651_106755642 | 3300025960 | Switchgrass Rhizosphere | MAAKRPRKRVASVREYVASKPKESRASLEAVRRAILKAVPNAQEGLAYQMPA |
| Ga0207703_103894562 | 3300026035 | Switchgrass Rhizosphere | MTAERSRKRLGSVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMP |
| Ga0207641_106705702 | 3300026088 | Switchgrass Rhizosphere | MAKRSRKRVASVREYIASKPKESRASLEAVRRAILKALPNAQEGLA |
| Ga0207675_1017076452 | 3300026118 | Switchgrass Rhizosphere | MTAKRSRTRVASVREYVASKPKESRASLEAVRRAILK |
| Ga0257152_10254512 | 3300026369 | Soil | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQ |
| Ga0257181_10449072 | 3300026499 | Soil | MTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0207428_107869611 | 3300027907 | Populus Rhizosphere | LLRSMTAKRSRTRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQMPAYTLN |
| Ga0209382_115654221 | 3300027909 | Populus Rhizosphere | MTAKRSRKRFASVREYVASKPKESRASLEAVRRAI |
| Ga0307277_103688781 | 3300028881 | Soil | MSAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALP |
| Ga0310813_110839122 | 3300031716 | Soil | MAMSVNNVRSMKAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGLAYQM |
| Ga0307469_101296251 | 3300031720 | Hardwood Forest Soil | MTAKRSRKRVASVREYVASKPKEHRASLEAVRRAILKALPNAQEGLAYQMP |
| Ga0310901_101404241 | 3300031940 | Soil | MRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPNAQEGL |
| Ga0310897_107086141 | 3300032003 | Soil | MTAKRSRKRVASVREYVASKPRESRASLEAVRRAILK |
| Ga0310890_101803813 | 3300032075 | Soil | MRGMTAKRSRKRVASVREYVASKPKESRASLEAVRRAILKALPK |
| Ga0310895_101388412 | 3300032122 | Soil | MTAKRSRKRVASVREYLASKPKESRASLGAVRRAILKA |
| Ga0307470_106130491 | 3300032174 | Hardwood Forest Soil | MAAKRSRKRVASVREYVLSKPKESRASLEAVRRAILKA |
| Ga0310810_111490221 | 3300033412 | Soil | MAMSVSNVRSMTAKRSRKRVASVREYIASKPKESRASLEAVR |
| ⦗Top⦘ |