


| Basic Information | |
|---|---|
| Family ID | F093447 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPARPHGK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.62 % |
| % of genes near scaffold ends (potentially truncated) | 14.15 % |
| % of genes from short scaffolds (< 2000 bps) | 72.64 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (4.717 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.642 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.849 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.88% β-sheet: 0.00% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF01964 | ThiC_Rad_SAM | 3.77 |
| PF14066 | DUF4256 | 2.83 |
| PF07978 | NIPSNAP | 2.83 |
| PF05491 | RuvB_C | 2.83 |
| PF01555 | N6_N4_Mtase | 1.89 |
| PF00149 | Metallophos | 1.89 |
| PF00535 | Glycos_transf_2 | 1.89 |
| PF01740 | STAS | 1.89 |
| PF07519 | Tannase | 1.89 |
| PF00795 | CN_hydrolase | 0.94 |
| PF13376 | OmdA | 0.94 |
| PF05598 | DUF772 | 0.94 |
| PF00578 | AhpC-TSA | 0.94 |
| PF06983 | 3-dmu-9_3-mt | 0.94 |
| PF00145 | DNA_methylase | 0.94 |
| PF00334 | NDK | 0.94 |
| PF13701 | DDE_Tnp_1_4 | 0.94 |
| PF04480 | DUF559 | 0.94 |
| PF13385 | Laminin_G_3 | 0.94 |
| PF03819 | MazG | 0.94 |
| PF03814 | KdpA | 0.94 |
| PF00005 | ABC_tran | 0.94 |
| PF03235 | DUF262 | 0.94 |
| PF07969 | Amidohydro_3 | 0.94 |
| PF06029 | AlkA_N | 0.94 |
| PF13145 | Rotamase_2 | 0.94 |
| PF00076 | RRM_1 | 0.94 |
| PF00075 | RNase_H | 0.94 |
| PF05221 | AdoHcyase | 0.94 |
| PF07589 | PEP-CTERM | 0.94 |
| PF12904 | Collagen_bind_2 | 0.94 |
| PF00512 | HisKA | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF00069 | Pkinase | 0.94 |
| PF08240 | ADH_N | 0.94 |
| PF07690 | MFS_1 | 0.94 |
| PF01370 | Epimerase | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 3.77 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.77 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 2.83 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.89 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.89 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.89 |
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 0.94 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.94 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.94 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.94 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.94 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.94 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.96 % |
| Unclassified | root | N/A | 16.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0745814 | All Organisms → cellular organisms → Bacteria | 25240 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101394102 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300000956|JGI10216J12902_115427522 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100248972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5863 | Open in IMG/M |
| 3300004011|Ga0055460_10256251 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004479|Ga0062595_100277736 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005286|Ga0065721_10084880 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300005294|Ga0065705_10146718 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300005294|Ga0065705_10488828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300005331|Ga0070670_102255552 | Not Available | 502 | Open in IMG/M |
| 3300005341|Ga0070691_10205369 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005435|Ga0070714_102175256 | Not Available | 540 | Open in IMG/M |
| 3300005531|Ga0070738_10008921 | All Organisms → cellular organisms → Bacteria | 9495 | Open in IMG/M |
| 3300005831|Ga0074471_10401034 | All Organisms → cellular organisms → Bacteria | 3304 | Open in IMG/M |
| 3300005836|Ga0074470_11421371 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300005841|Ga0068863_100714013 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005841|Ga0068863_101247603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 750 | Open in IMG/M |
| 3300006162|Ga0075030_100288783 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300006844|Ga0075428_102487821 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006865|Ga0073934_10056408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR034 | 3336 | Open in IMG/M |
| 3300006865|Ga0073934_10312267 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300006904|Ga0075424_100554897 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1227 | Open in IMG/M |
| 3300006904|Ga0075424_101465987 | Not Available | 724 | Open in IMG/M |
| 3300009095|Ga0079224_100349070 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300009162|Ga0075423_10800243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 997 | Open in IMG/M |
| 3300009162|Ga0075423_11397930 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009506|Ga0118657_10002120 | All Organisms → cellular organisms → Bacteria | 39372 | Open in IMG/M |
| 3300009609|Ga0105347_1138358 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009675|Ga0116149_1011946 | All Organisms → cellular organisms → Bacteria | 6758 | Open in IMG/M |
| 3300009678|Ga0105252_10040981 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300009792|Ga0126374_11237069 | Not Available | 600 | Open in IMG/M |
| 3300010037|Ga0126304_10071725 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300010040|Ga0126308_10912416 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010041|Ga0126312_10077204 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300010361|Ga0126378_12625076 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 575 | Open in IMG/M |
| 3300010366|Ga0126379_10781806 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010371|Ga0134125_11288186 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300010397|Ga0134124_10193756 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1841 | Open in IMG/M |
| 3300010399|Ga0134127_11439814 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010400|Ga0134122_10123623 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300011422|Ga0137425_1092870 | Not Available | 725 | Open in IMG/M |
| 3300012203|Ga0137399_10873231 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012929|Ga0137404_10100968 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 2328 | Open in IMG/M |
| 3300012956|Ga0154020_10014417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 8923 | Open in IMG/M |
| 3300012956|Ga0154020_10301445 | Not Available | 1415 | Open in IMG/M |
| 3300012971|Ga0126369_12387636 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300013296|Ga0157374_11504233 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300013308|Ga0157375_12490915 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300013502|Ga0119901_1230525 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300014160|Ga0181517_10139045 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300014262|Ga0075301_1168247 | Not Available | 520 | Open in IMG/M |
| 3300014323|Ga0075356_1232831 | Not Available | 510 | Open in IMG/M |
| 3300014325|Ga0163163_10264274 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300014493|Ga0182016_10003395 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 18237 | Open in IMG/M |
| 3300014499|Ga0182012_10438365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 856 | Open in IMG/M |
| 3300014499|Ga0182012_10884470 | Not Available | 564 | Open in IMG/M |
| 3300015259|Ga0180085_1064788 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300015360|Ga0163144_10307780 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300017973|Ga0187780_10120745 | All Organisms → cellular organisms → Bacteria → PVC group | 1811 | Open in IMG/M |
| 3300017975|Ga0187782_10781606 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018083|Ga0184628_10030842 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300018085|Ga0187772_10008518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 5465 | Open in IMG/M |
| 3300018085|Ga0187772_10807242 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300018090|Ga0187770_11136085 | Not Available | 631 | Open in IMG/M |
| 3300018432|Ga0190275_10309334 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300018481|Ga0190271_12108760 | Not Available | 671 | Open in IMG/M |
| 3300019222|Ga0179957_1236297 | Not Available | 808 | Open in IMG/M |
| 3300019487|Ga0187893_10100887 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300020057|Ga0163151_10071085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 2391 | Open in IMG/M |
| 3300020579|Ga0210407_10715452 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300021420|Ga0210394_10456289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1125 | Open in IMG/M |
| 3300021475|Ga0210392_10079949 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300021478|Ga0210402_11506817 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025310|Ga0209172_10034130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3337 | Open in IMG/M |
| 3300025310|Ga0209172_10254323 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025629|Ga0208824_1069368 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300025920|Ga0207649_11091535 | Not Available | 629 | Open in IMG/M |
| 3300025924|Ga0207694_10321594 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300025959|Ga0210116_1068469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 687 | Open in IMG/M |
| 3300026088|Ga0207641_10318968 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027879|Ga0209169_10234902 | Not Available | 960 | Open in IMG/M |
| 3300027911|Ga0209698_10161514 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300028779|Ga0302266_10122930 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300028785|Ga0302201_10353415 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 577 | Open in IMG/M |
| 3300029911|Ga0311361_10220218 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300030004|Ga0302186_10329126 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
| 3300030045|Ga0302282_1172020 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300030507|Ga0302192_10053363 | Not Available | 2056 | Open in IMG/M |
| 3300030606|Ga0299906_10048911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3371 | Open in IMG/M |
| 3300031708|Ga0310686_100297842 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300031711|Ga0265314_10082475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 2115 | Open in IMG/M |
| 3300031726|Ga0302321_101059525 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031726|Ga0302321_102951869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium LR76 | 555 | Open in IMG/M |
| 3300031821|Ga0318567_10383860 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031902|Ga0302322_100842847 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300031910|Ga0306923_11215843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 805 | Open in IMG/M |
| 3300032157|Ga0315912_10000158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 155893 | Open in IMG/M |
| 3300032180|Ga0307471_103054916 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032261|Ga0306920_103718031 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032261|Ga0306920_103765133 | Not Available | 555 | Open in IMG/M |
| 3300032770|Ga0335085_10678792 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300032770|Ga0335085_11862358 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032782|Ga0335082_10434856 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300033485|Ga0316626_11645698 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300033485|Ga0316626_12078417 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.72% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 3.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.77% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.83% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.83% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.94% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.94% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.94% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.94% |
| Rice-Straw Enriched Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost | 0.94% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.94% |
| Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005286 | Mesophilic microbial community from rice straw/compost enrichment Sample: eDNA_1 | Engineered | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013502 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612 | Engineered | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030004 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_074581421 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKLEMRQKLAREPFEEKIRKVAQLIRLAKTFPRRPKLSPPPQGK* |
| INPhiseqgaiiFebDRAFT_1013941021 | 3300000364 | Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLARTFPRRPRPTPSHPHGK* |
| JGI10216J12902_1154275221 | 3300000956 | Soil | MKLVMRQKLAREPFAQKIRKVAQLIRLAKSFPRRQRPVTAHPHGK* |
| JGIcombinedJ13530_1002489726 | 3300001213 | Wetland | MKLEMRQKLAREPFAEKIRKVSQLIRLAKAFPRRPRLTPAQRKAG* |
| Ga0055460_102562512 | 3300004011 | Natural And Restored Wetlands | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLSPAQPHGK* |
| Ga0062595_1002777361 | 3300004479 | Soil | MKSEMRQKLARESFEEKIRKVAQLIRLAKSFSQRPRSPIRASAK* |
| Ga0065721_100848803 | 3300005286 | Rice-Straw Enriched Compost | MKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRLIHAHPHGK* |
| Ga0065705_101467184 | 3300005294 | Switchgrass Rhizosphere | MKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRPMPAQPHGK* |
| Ga0065705_104888283 | 3300005294 | Switchgrass Rhizosphere | MKAEMRQKLAREPFKEKIRKVAQLIRLAKTFPRRQRLTPSQPHSK* |
| Ga0070670_1022555521 | 3300005331 | Switchgrass Rhizosphere | MKAEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARNAGSR* |
| Ga0070691_102053691 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIEMRRKLARESFEEKIRKVAQLVRLAKNFSRRSRRDLDNAGK* |
| Ga0070714_1021752562 | 3300005435 | Agricultural Soil | MTPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQQAAPARPKGHGN* |
| Ga0070738_100089215 | 3300005531 | Surface Soil | MKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPHRARLARNARS* |
| Ga0074471_104010341 | 3300005831 | Sediment (Intertidal) | FEAADIMKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPPTALRRR* |
| Ga0074470_114213712 | 3300005836 | Sediment (Intertidal) | MKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRAAPAHSQGN* |
| Ga0068863_1007140132 | 3300005841 | Switchgrass Rhizosphere | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAHPRDK* |
| Ga0068863_1012476031 | 3300005841 | Switchgrass Rhizosphere | VEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARYARS* |
| Ga0075030_1002887832 | 3300006162 | Watersheds | MKLGMRQKLARKPFAEKIRKVGQLIRLAKTFPRRPQLTPTHRKAS* |
| Ga0075428_1024878211 | 3300006844 | Populus Rhizosphere | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRSRLTPAQPHGR* |
| Ga0073934_100564085 | 3300006865 | Hot Spring Sediment | MKAEMRQKLARESFEEKTRKVAQLIRLAKTFPRRPRPTHAHPQGK* |
| Ga0073934_103122671 | 3300006865 | Hot Spring Sediment | MKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRPIPAHPNGK* |
| Ga0075424_1005548971 | 3300006904 | Populus Rhizosphere | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPR |
| Ga0075424_1014659872 | 3300006904 | Populus Rhizosphere | MKAGMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRFPHGK* |
| Ga0079224_1003490704 | 3300009095 | Agricultural Soil | MKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRLTHAHPHGK* |
| Ga0075423_108002433 | 3300009162 | Populus Rhizosphere | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRKRLTPAQPHGK* |
| Ga0075423_113979302 | 3300009162 | Populus Rhizosphere | MKAEMPQKLAREPFSEKIRKVQLIRLAKTIPRRPRRTPAQPHGK* |
| Ga0118657_1000212019 | 3300009506 | Mangrove Sediment | MKAEMRQKLAREPFAEKIRKVSQLIRLAKTFPRRPRLTPSHPHGK* |
| Ga0105347_11383582 | 3300009609 | Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAQPRCATSA |
| Ga0116149_10119465 | 3300009675 | Anaerobic Digestor Sludge | MKPEMRQKLAREPFAEKIRKVAQLIRLAKAFPRRPRVTPAHPYGK* |
| Ga0105252_100409812 | 3300009678 | Soil | MKLEMRKQLAREPFVEKIRKVAQLIRLAKTFPRRPRPAPADRKTS* |
| Ga0126374_112370692 | 3300009792 | Tropical Forest Soil | MKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPRRSRLALSRPGDK* |
| Ga0126304_100717252 | 3300010037 | Serpentine Soil | MKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRPTSGHPGNK* |
| Ga0126308_109124163 | 3300010040 | Serpentine Soil | MKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRLTSGHPGSK* |
| Ga0126312_100772043 | 3300010041 | Serpentine Soil | MKTEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRRRPTSGHPGSK* |
| Ga0126378_126250761 | 3300010361 | Tropical Forest Soil | MKAEMRRKLAREPFAEKIRKVAQLIRLVKTFPPRPRITPSHPHGSDIPGAMGTR* |
| Ga0126379_107818061 | 3300010366 | Tropical Forest Soil | MKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPHRSRLALSRPRDK* |
| Ga0134125_112881862 | 3300010371 | Terrestrial Soil | MKLEMRQKLAREPFAEKIRKVAQLIRLVKTFPRRARRR* |
| Ga0134124_101937562 | 3300010397 | Terrestrial Soil | MKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRARLARYARS* |
| Ga0134127_114398142 | 3300010399 | Terrestrial Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPARPHGK* |
| Ga0134122_101236233 | 3300010400 | Terrestrial Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPPLTPSHPHGK* |
| Ga0137425_10928702 | 3300011422 | Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRKRLTPPQPHGQ* |
| Ga0137399_108732311 | 3300012203 | Vadose Zone Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRARPTPSHPHGK* |
| Ga0137404_101009683 | 3300012929 | Vadose Zone Soil | MKPEMRRKLARESFEEKIRKVAQLIRLAKNISRRPKQAVRASGK* |
| Ga0154020_100144179 | 3300012956 | Active Sludge | MKPEMRQKLAAESFAEKIRKVAQLIRLAKTFPRRPRPASAPPHGK* |
| Ga0154020_103014455 | 3300012956 | Active Sludge | MKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTSAHPHGK* |
| Ga0126369_123876361 | 3300012971 | Tropical Forest Soil | MKAEMRQKLAREPFAEKMRKVAQLIRLAKTFPRRSRLALSRPR* |
| Ga0157374_115042331 | 3300013296 | Miscanthus Rhizosphere | MKVEMRQKLAREPFPEKIRKVAQLIRLAKTFPHRARLARNPRS* |
| Ga0157375_124909152 | 3300013308 | Miscanthus Rhizosphere | MKAEMRQKLAREPFAEKIRKVAKLIRLAKTFPCRPRLTPAHPHSK* |
| Ga0119901_12305251 | 3300013502 | Activated Sludge | MKPETRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAQPH |
| Ga0181517_101390453 | 3300014160 | Bog | MKPEMRQKLAREPFAEKVRKVAQLVRLAKTFPRSSRQPGNGTVR* |
| Ga0075301_11682472 | 3300014262 | Natural And Restored Wetlands | VKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLIPAHPHGK* |
| Ga0075356_12328312 | 3300014323 | Natural And Restored Wetlands | MKPEMRQKLAREPFAEKIRKVAQLIRLAKTFSRRPRQQPSRK* |
| Ga0163163_102642742 | 3300014325 | Switchgrass Rhizosphere | MKAEMRQKLASEPFAEKIRKVVQLIRLAKTFPRRRRLASTHIQGE* |
| Ga0182016_100033952 | 3300014493 | Bog | MKLEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG* |
| Ga0182012_104383651 | 3300014499 | Bog | MRQKLAKEPFAEKIRKVGQLIRLAKTFPRRSDLSKTSRRPGK* |
| Ga0182012_108844702 | 3300014499 | Bog | MKQEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG* |
| Ga0180085_10647882 | 3300015259 | Soil | MKTEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPPHPHGK* |
| Ga0163144_103077805 | 3300015360 | Freshwater Microbial Mat | MKAEMRQKLARESFAEKIRKVAQLIRLAKTFPHRNRLNHRPAAR* |
| Ga0187780_101207453 | 3300017973 | Tropical Peatland | MKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRLNSVHPHGK |
| Ga0187782_107816062 | 3300017975 | Tropical Peatland | MKPEMRQKLAREPFAQKVRKVAQLIRLAKTFPRRQRRQPATRGAQQ |
| Ga0184628_100308426 | 3300018083 | Groundwater Sediment | MKAEMRQKLAREPFAEKIRKVARLIRLAKTFPRRKRLTPAQPHGK |
| Ga0187772_100085185 | 3300018085 | Tropical Peatland | MKPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRSRLKPGRKAS |
| Ga0187772_108072422 | 3300018085 | Tropical Peatland | MKPEMRQKLAREPFVEKIRKVAQLIRLAKTFPRRPRMTSAHPHGK |
| Ga0187770_111360852 | 3300018090 | Tropical Peatland | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRCPRQQPATRTAR |
| Ga0190275_103093342 | 3300018432 | Soil | MKAEMRQKLAREAFAEKIRKVAQLIRLAKTFPRRPRLMPRHSHDGK |
| Ga0190271_121087602 | 3300018481 | Soil | MKAEMRLKLARQPFAEKIRKVAQLIRLAKTFPRRPRLNSAQPHGK |
| Ga0179957_12362974 | 3300019222 | Anaerobic Digestor Sludge | PEMRQKLAREPFAEKIRKVAQLIRQAKALPRRPRPTPAHQHGK |
| Ga0187893_101008876 | 3300019487 | Microbial Mat On Rocks | MKAEMRQKLAREPFTEKIRKVAQLIRLAKTFPRRKGLTPAQPHGK |
| Ga0163151_100710854 | 3300020057 | Freshwater Microbial Mat | MKAEMRQKLARESFAEKIRKVAQLIRLAKTFPHRNRLNHRPAAR |
| Ga0210407_107154521 | 3300020579 | Soil | TAEIMKPEMRRKLAREPFEEKIRKVAQLIHLAKNISRRPRQAVRASGK |
| Ga0210394_104562893 | 3300021420 | Soil | MKTEMRQKLTREPFEEKIRKVARLIRLAKTFPRRQRESQPPRAAK |
| Ga0210392_100799492 | 3300021475 | Soil | MKEKMRLKLAREPFAEKIRKVAQLIRLAKNFPRRQRELRISRSAR |
| Ga0210402_115068171 | 3300021478 | Soil | MKLEMRLKLAREPFEEKIRKVGQLIRLAKTFPRAPLSTPSRPPA |
| Ga0209172_100341303 | 3300025310 | Hot Spring Sediment | MKAEMRQKLARESFEEKTRKVAQLIRLAKTFPRRPRPTHAHPQGK |
| Ga0209172_102543233 | 3300025310 | Hot Spring Sediment | MKPEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRPIPAHPNGK |
| Ga0208824_10693683 | 3300025629 | Anaerobic Digestor Sludge | MKPEMRQKLAREPFAEKIRKVAQLIRQAKALPRRPRPTPAHQHGK |
| Ga0207649_110915352 | 3300025920 | Corn Rhizosphere | MKPEMRQKLARESFPEKIRKVAQLIRLAKTFPRRARVTRNAGSR |
| Ga0207694_103215942 | 3300025924 | Corn Rhizosphere | MTPEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQQAAPARPKGHGN |
| Ga0210116_10684691 | 3300025959 | Natural And Restored Wetlands | TETANAMKLEMRQKLARESFAEKIRKVSQLIRLAKTFPRRQRLTPAQLHDK |
| Ga0207641_103189682 | 3300026088 | Switchgrass Rhizosphere | MKAEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTPAHPRDK |
| Ga0209169_102349023 | 3300027879 | Soil | MKQQMRQKLAREPFAQKIRKVAQLIRLAKSFPRRPRV |
| Ga0209698_101615143 | 3300027911 | Watersheds | MKLGMRQKLARKPFAEKIRKVGQLIRLAKTFPRRPQLTPTHRKAS |
| Ga0302266_101229303 | 3300028779 | Bog | MKLEMRQKLAKEPFAEKIRKVGQLIRLAKTFPRRSDLSKTSRRPGK |
| Ga0302201_103534152 | 3300028785 | Bog | SIMKLEMRQKLAKEPFVEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK |
| Ga0311361_102202183 | 3300029911 | Bog | MKLEMRQKLAKEPFVEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK |
| Ga0311365_114388341 | 3300029989 | Fen | RQKLAREPFAEKILKVGQLIRLAKTFPRRTRLQSPTKSKA |
| Ga0302186_103291262 | 3300030004 | Bog | MTLEMRNKLAREPFEENIRKVSQLLRLVKTFPRHQKFKQRRRPSP |
| Ga0302282_11720202 | 3300030045 | Fen | MKLEMRQKLAKEPFAEKVRKVGQLIRLAKTFPRRSDLSKTSRRPGK |
| Ga0302192_100533632 | 3300030507 | Bog | MKLEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRPRLTPAHRKAG |
| Ga0299906_100489113 | 3300030606 | Soil | MKAEMRQKLARESFEKKIRKVAQLIRLAKTFPGRQRVTPAQRKAN |
| Ga0310686_1002978423 | 3300031708 | Soil | MKPEMRQKLAREPFPEKIRKVARLIRLAKTFPRRQRESQSTPAAK |
| Ga0265314_100824752 | 3300031711 | Rhizosphere | MKPDMRQKLAREPFAEKIRKVAQLIQLAKAFPRRPRRQLDNGNSR |
| Ga0302321_1010595252 | 3300031726 | Fen | MKMEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRTRLQSPTKSKA |
| Ga0302321_1029518692 | 3300031726 | Fen | MKPEMRQKLATESFAEKIRKVAQLIRLAKTFPRRQRPVSAQPHGK |
| Ga0318567_103838602 | 3300031821 | Soil | VKLEMRQKLAREPFAQKIRKVEQLVRLAKTFPRRAPLASRPAQRRATH |
| Ga0302322_1008428472 | 3300031902 | Fen | MKIEMRQKLAREPFAEKIRKVGQLIRLAKTFPRRSRLQSSTKSKA |
| Ga0306923_112158432 | 3300031910 | Soil | MRQKLAREPFAQKIRKVEQLVRLAKTFPRRAPLASRPAQRRATH |
| Ga0315912_100001583 | 3300032157 | Soil | MKPELRQKLAREPFAERIRKVAQLIRLAKTFPRRPRLTPVQPHGK |
| Ga0307471_1030549161 | 3300032180 | Hardwood Forest Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLSKTFPRRPRLTPARPHGK |
| Ga0306920_1037180311 | 3300032261 | Soil | MKAEMRQKLAREPFAEKIRKVAQLIRLAKNFPRRPRLTPSHPHGKI |
| Ga0306920_1037651332 | 3300032261 | Soil | TEAVKAEMRQKLAREPFAEKIRKVAQLIRLAKNFPRRPRLTPSHPHGKIEN |
| Ga0335085_106787922 | 3300032770 | Soil | MKAELRRKLAREPFAEKIRKVAQLIPLAKTFPRHQRLTLPRPHGK |
| Ga0335085_118623582 | 3300032770 | Soil | MKLEMRQKLAREPFAEKIRKVAQLIHLAKTFPRRQRRQPATRASR |
| Ga0335082_104348562 | 3300032782 | Soil | MKAEMRQKLAREPFPEKIRKVAQLIRLAKTFPRRPRFTPSPLHGK |
| Ga0316626_116456982 | 3300033485 | Soil | MKAELRQKLAREPFAEKIRKVAQLIRLAKTFPRRPRLTTAQPHDK |
| Ga0316626_120784172 | 3300033485 | Soil | MKTEMRQKLAREPFAEKIRKVAQLIRLAKTFPRRQRPTPAHLHGK |
| ⦗Top⦘ |