


| Basic Information | |
|---|---|
| Family ID | F093172 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SVAEEAVSGVFIWLSDFKPSDALAASLFNPPMKYPG |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.83 % |
| % of genes near scaffold ends (potentially truncated) | 95.28 % |
| % of genes from short scaffolds (< 2000 bps) | 72.64 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.925 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen (12.264 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.415 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (31.132 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.06% β-sheet: 0.00% Coil/Unstructured: 60.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13701 | DDE_Tnp_1_4 | 6.60 |
| PF01609 | DDE_Tnp_1 | 3.77 |
| PF02371 | Transposase_20 | 1.89 |
| PF08308 | PEGA | 1.89 |
| PF00589 | Phage_integrase | 1.89 |
| PF10592 | AIPR | 0.94 |
| PF03720 | UDPG_MGDP_dh_C | 0.94 |
| PF02894 | GFO_IDH_MocA_C | 0.94 |
| PF06439 | 3keto-disac_hyd | 0.94 |
| PF00106 | adh_short | 0.94 |
| PF13362 | Toprim_3 | 0.94 |
| PF00293 | NUDIX | 0.94 |
| PF03551 | PadR | 0.94 |
| PF14706 | Tnp_DNA_bind | 0.94 |
| PF00400 | WD40 | 0.94 |
| PF11736 | DUF3299 | 0.94 |
| PF00507 | Oxidored_q4 | 0.94 |
| PF06071 | YchF-GTPase_C | 0.94 |
| PF00535 | Glycos_transf_2 | 0.94 |
| PF09617 | Cas_GSU0053 | 0.94 |
| PF07705 | CARDB | 0.94 |
| PF07610 | DUF1573 | 0.94 |
| PF08482 | HrpB_C | 0.94 |
| PF16269 | DUF4922 | 0.94 |
| PF07724 | AAA_2 | 0.94 |
| PF12686 | DUF3800 | 0.94 |
| PF16347 | DUF4976 | 0.94 |
| PF02668 | TauD | 0.94 |
| PF00403 | HMA | 0.94 |
| PF01619 | Pro_dh | 0.94 |
| PF13361 | UvrD_C | 0.94 |
| PF03331 | LpxC | 0.94 |
| PF01895 | PhoU | 0.94 |
| PF14317 | YcxB | 0.94 |
| PF01272 | GreA_GreB | 0.94 |
| PF02911 | Formyl_trans_C | 0.94 |
| PF13546 | DDE_5 | 0.94 |
| PF13641 | Glyco_tranf_2_3 | 0.94 |
| PF13384 | HTH_23 | 0.94 |
| PF05592 | Bac_rhamnosid | 0.94 |
| PF07642 | BBP2 | 0.94 |
| PF00821 | PEPCK_GTP | 0.94 |
| PF13229 | Beta_helix | 0.94 |
| PF00210 | Ferritin | 0.94 |
| PF14686 | fn3_3 | 0.94 |
| PF00690 | Cation_ATPase_N | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF04465 | DUF499 | 0.94 |
| PF12850 | Metallophos_2 | 0.94 |
| PF00590 | TP_methylase | 0.94 |
| PF01139 | RtcB | 0.94 |
| PF13676 | TIR_2 | 0.94 |
| PF07690 | MFS_1 | 0.94 |
| PF13544 | Obsolete Pfam Family | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 3.77 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 3.77 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 3.77 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 3.77 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 3.77 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 3.77 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.89 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.94 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.94 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.94 |
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.94 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.94 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.94 |
| COG1643 | HrpA-like RNA helicase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.94 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.94 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.94 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.92 % |
| Unclassified | root | N/A | 32.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig374393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300005563|Ga0068855_100026184 | All Organisms → cellular organisms → Bacteria | 6978 | Open in IMG/M |
| 3300005563|Ga0068855_101196426 | All Organisms → cellular organisms → Bacteria → PVC group | 790 | Open in IMG/M |
| 3300009038|Ga0099829_10124840 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300009131|Ga0115027_11024168 | Not Available | 648 | Open in IMG/M |
| 3300009137|Ga0066709_101149982 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300009175|Ga0073936_10794752 | Not Available | 513 | Open in IMG/M |
| 3300009502|Ga0114951_10005032 | All Organisms → cellular organisms → Bacteria | 12433 | Open in IMG/M |
| 3300009502|Ga0114951_10104772 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300009502|Ga0114951_10218309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp. Root1423 | 1012 | Open in IMG/M |
| 3300009502|Ga0114951_10448858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 636 | Open in IMG/M |
| 3300009609|Ga0105347_1408195 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009631|Ga0116115_1106044 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009640|Ga0116126_1048156 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300009640|Ga0116126_1165512 | Not Available | 731 | Open in IMG/M |
| 3300010352|Ga0116247_10532442 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 901 | Open in IMG/M |
| 3300012038|Ga0137431_1123221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 734 | Open in IMG/M |
| 3300012203|Ga0137399_10102600 | Not Available | 2215 | Open in IMG/M |
| 3300012917|Ga0137395_10671590 | Not Available | 749 | Open in IMG/M |
| 3300012931|Ga0153915_12944657 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300014153|Ga0181527_1026851 | All Organisms → cellular organisms → Bacteria | 3530 | Open in IMG/M |
| 3300014156|Ga0181518_10004512 | All Organisms → cellular organisms → Bacteria | 12379 | Open in IMG/M |
| 3300014156|Ga0181518_10028977 | All Organisms → cellular organisms → Bacteria | 3613 | Open in IMG/M |
| 3300014156|Ga0181518_10030452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3500 | Open in IMG/M |
| 3300014160|Ga0181517_10143109 | Not Available | 1350 | Open in IMG/M |
| 3300014201|Ga0181537_10619051 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300014308|Ga0075354_1077764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 659 | Open in IMG/M |
| 3300014490|Ga0182010_10052289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1950 | Open in IMG/M |
| 3300014490|Ga0182010_10481847 | Not Available | 684 | Open in IMG/M |
| 3300014491|Ga0182014_10449956 | Not Available | 636 | Open in IMG/M |
| 3300014493|Ga0182016_10202382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1281 | Open in IMG/M |
| 3300014496|Ga0182011_10445242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 840 | Open in IMG/M |
| 3300014498|Ga0182019_10513868 | Not Available | 832 | Open in IMG/M |
| 3300014501|Ga0182024_12562874 | Not Available | 548 | Open in IMG/M |
| 3300014502|Ga0182021_10430269 | Not Available | 1568 | Open in IMG/M |
| 3300014502|Ga0182021_11632220 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300014839|Ga0182027_10240158 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300014839|Ga0182027_10518182 | Not Available | 1298 | Open in IMG/M |
| 3300014839|Ga0182027_10541252 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300014839|Ga0182027_11075759 | Not Available | 818 | Open in IMG/M |
| 3300014839|Ga0182027_11179561 | Not Available | 772 | Open in IMG/M |
| 3300014839|Ga0182027_11636027 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300014839|Ga0182027_11763607 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017946|Ga0187879_10256869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 973 | Open in IMG/M |
| 3300017970|Ga0187783_10890671 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300017988|Ga0181520_10866731 | Not Available | 605 | Open in IMG/M |
| 3300018003|Ga0187876_1272217 | Not Available | 546 | Open in IMG/M |
| 3300018014|Ga0187860_1003293 | All Organisms → cellular organisms → Bacteria | 12852 | Open in IMG/M |
| 3300018017|Ga0187872_10034906 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2783 | Open in IMG/M |
| 3300018040|Ga0187862_10042380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 3355 | Open in IMG/M |
| 3300018064|Ga0187773_10832406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 590 | Open in IMG/M |
| 3300021072|Ga0194057_10290792 | Not Available | 564 | Open in IMG/M |
| 3300021073|Ga0210378_10029328 | Not Available | 2199 | Open in IMG/M |
| 3300021473|Ga0194043_1286408 | Not Available | 526 | Open in IMG/M |
| 3300022555|Ga0212088_10023776 | All Organisms → cellular organisms → Bacteria | 7960 | Open in IMG/M |
| 3300022555|Ga0212088_10033716 | All Organisms → cellular organisms → Bacteria | 6085 | Open in IMG/M |
| 3300022555|Ga0212088_10125792 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300022555|Ga0212088_10352602 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300022850|Ga0224552_1030722 | Not Available | 741 | Open in IMG/M |
| 3300022850|Ga0224552_1052798 | Not Available | 572 | Open in IMG/M |
| 3300023090|Ga0224558_1088033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1118 | Open in IMG/M |
| 3300023090|Ga0224558_1186654 | Not Available | 635 | Open in IMG/M |
| 3300025316|Ga0209697_10065865 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 2639 | Open in IMG/M |
| 3300025576|Ga0208820_1097042 | Not Available | 727 | Open in IMG/M |
| 3300025650|Ga0209385_1015226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 3165 | Open in IMG/M |
| 3300025864|Ga0209429_10285243 | Not Available | 639 | Open in IMG/M |
| 3300025921|Ga0207652_10279348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1506 | Open in IMG/M |
| 3300026463|Ga0256815_1041600 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
| 3300027655|Ga0209388_1116057 | Not Available | 765 | Open in IMG/M |
| 3300027885|Ga0209450_10344591 | Not Available | 1082 | Open in IMG/M |
| 3300027896|Ga0209777_10140098 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300027896|Ga0209777_10302366 | Not Available | 1236 | Open in IMG/M |
| 3300027896|Ga0209777_10619580 | Not Available | 780 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10334868 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10081933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300028577|Ga0265318_10043678 | Not Available | 1697 | Open in IMG/M |
| 3300029883|Ga0311327_10402319 | Not Available | 861 | Open in IMG/M |
| 3300029911|Ga0311361_10075331 | All Organisms → cellular organisms → Bacteria | 5063 | Open in IMG/M |
| 3300029911|Ga0311361_10641286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300029914|Ga0311359_10136026 | Not Available | 2288 | Open in IMG/M |
| 3300029915|Ga0311358_10294745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1381 | Open in IMG/M |
| 3300029922|Ga0311363_10053911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6174 | Open in IMG/M |
| 3300029952|Ga0311346_11347448 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300029954|Ga0311331_11137735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 664 | Open in IMG/M |
| 3300030518|Ga0302275_10414742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300031344|Ga0265316_10124228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1947 | Open in IMG/M |
| 3300031524|Ga0302320_10191881 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300031524|Ga0302320_11142992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 806 | Open in IMG/M |
| 3300031672|Ga0307373_10628822 | Not Available | 542 | Open in IMG/M |
| 3300031726|Ga0302321_100648859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300031772|Ga0315288_10062175 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera | 4398 | Open in IMG/M |
| 3300031902|Ga0302322_101929130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300032156|Ga0315295_10179111 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300032156|Ga0315295_11427195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 670 | Open in IMG/M |
| 3300032180|Ga0307471_103621517 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300032275|Ga0315270_10469652 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032401|Ga0315275_10037866 | All Organisms → cellular organisms → Bacteria | 5106 | Open in IMG/M |
| 3300032516|Ga0315273_10577432 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300032895|Ga0335074_10277980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1938 | Open in IMG/M |
| 3300032895|Ga0335074_10742397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 933 | Open in IMG/M |
| 3300032896|Ga0335075_10002367 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 30401 | Open in IMG/M |
| 3300032896|Ga0335075_10013028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 12537 | Open in IMG/M |
| 3300033480|Ga0316620_10385231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1261 | Open in IMG/M |
| 3300033488|Ga0316621_11371620 | Not Available | 539 | Open in IMG/M |
| 3300033823|Ga0334837_017263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 2806 | Open in IMG/M |
| 3300033823|Ga0334837_070621 | Not Available | 801 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 12.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 9.43% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.60% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 5.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 5.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.72% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.77% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.83% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.89% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.94% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021072 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15m | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026463 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6 | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_02275010 | 2140918008 | Soil | QSVVEEAVSRVFIWLNDFKPSDALAASLFNPSVKYPG |
| Ga0068855_1000261841 | 3300005563 | Corn Rhizosphere | SSGCSLQSVAEEAVCGVFIWLSDIKPFDAATASLVNPPMKYPG* |
| Ga0068855_1011964263 | 3300005563 | Corn Rhizosphere | QSVVEEAVRCVFIWLSDIKPFDAATASLVNPSMKYPG* |
| Ga0099829_101248401 | 3300009038 | Vadose Zone Soil | SLQSVVEEAVLGLFIWLSDFKPSDALAASLFDPTMKYPG* |
| Ga0115027_110241681 | 3300009131 | Wetland | PLQSVLEEAVSRGFIGLSVYKPSDALAASLFNPSVIYDG* |
| Ga0066709_1011499821 | 3300009137 | Grasslands Soil | SVAEEAVSGVFIWLSDFKPSDALAASLFNPPMKYPG* |
| Ga0073936_107947521 | 3300009175 | Freshwater Lake Hypolimnion | GWWLQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG* |
| Ga0114951_100050321 | 3300009502 | Freshwater | SVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG* |
| Ga0114951_101047723 | 3300009502 | Freshwater | WLQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG* |
| Ga0114951_102183092 | 3300009502 | Freshwater | WWLQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG* |
| Ga0114951_104488581 | 3300009502 | Freshwater | LQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG* |
| Ga0105347_14081953 | 3300009609 | Soil | FLQSAEEEAVSGDFIGLNHFKPFDALSAPSFNSPMKYPG* |
| Ga0116115_11060442 | 3300009631 | Peatland | VIEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG* |
| Ga0116126_10481561 | 3300009640 | Peatland | WLQSVIEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG* |
| Ga0116126_11655122 | 3300009640 | Peatland | SVIEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG* |
| Ga0116247_105324422 | 3300010352 | Anaerobic Digestor Sludge | IGWKLQSVVEEAVSRVFIGLSDFKPSDAFAASLFNPSMKYPG* |
| Ga0137431_11232211 | 3300012038 | Soil | WFLHSVAEEAVGGCFIWLSNDKPDDAPAASLFNSTVKYPG* |
| Ga0137399_101026004 | 3300012203 | Vadose Zone Soil | VPEEAVFGVFIWLSDFKPSDAFTASLFNSAMKYPG* |
| Ga0137395_106715901 | 3300012917 | Vadose Zone Soil | SVLEEAVIGVFIWLSDIKPSDAFAASLFNSTMKFPG* |
| Ga0153915_129446572 | 3300012931 | Freshwater Wetlands | MGWRLQSVAEEAVSDVFIGLNNFKPSDALAASSFNSAMKYPG* |
| Ga0181527_10268515 | 3300014153 | Bog | LEEAVSGVFIGLSVFKPSDAFAASLFNPIMTFPD* |
| Ga0181518_1000451214 | 3300014156 | Bog | CSLQSVLEEAVSGVFIGLSVFKPSDAFAASLFNPIMTFPD* |
| Ga0181518_100289771 | 3300014156 | Bog | WLQSVVEEAVSRVFIWLSDFKPSDALAASLFNTSMNYAG* |
| Ga0181518_100304528 | 3300014156 | Bog | CCLQSVVEEAASGAFIWLNNIKPSDAFAASLFNPFMKYAG* |
| Ga0181517_101431093 | 3300014160 | Bog | QSVVEEAVSGVFIWLSDFKPSDPLAASLFNPTMKYPG* |
| Ga0181537_106190512 | 3300014201 | Bog | VVQEAVSGVFIWLSDIKPMDALAASLVNPIMKYPG* |
| Ga0075354_10777641 | 3300014308 | Natural And Restored Wetlands | MGWRLQSVAEEAVSDVCIGLNDFKPSDALAASSFNSTVKFPG* |
| Ga0182010_100522893 | 3300014490 | Fen | CSLQSVLEEAASGVFIGLGVFKPSDAFAASLFNPTMNFPG* |
| Ga0182010_104818471 | 3300014490 | Fen | NRSDWALQSVAEEAASGVFIWLSDIKPSDALAASLFNAIVIYPG* |
| Ga0182014_104499562 | 3300014491 | Bog | VAEEAASGVFIWLSDIKPSDALAASLFNPIVIYPG* |
| Ga0182016_102023821 | 3300014493 | Bog | QSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG* |
| Ga0182011_104452421 | 3300014496 | Fen | QSVLEEAASGVFIGLGVFKPSDAFAASLFNPTMNFPG* |
| Ga0182019_105138682 | 3300014498 | Fen | SLQSVLEEAASGVFIGLGVFKPSDAFAASLFNPTVNFLG* |
| Ga0182024_125628742 | 3300014501 | Permafrost | LQSVAEEAVRFVFIWMSDINPFDALAASLFDSTMKYPG* |
| Ga0182021_104302695 | 3300014502 | Fen | VIEEAVSRGFIWLSVYKPSDALAASLFNLSVKYYG* |
| Ga0182021_116322201 | 3300014502 | Fen | ALQSVEEEAASGVFIWLSDIKPSDAFAASLFNPSMKFAG* |
| Ga0182027_102401581 | 3300014839 | Fen | GWRLQSVEEEAASGVFIWLSDIKPSDALAASLFNLSMKYAG* |
| Ga0182027_105181821 | 3300014839 | Fen | GWSLHSVLEEAVRLVFIWLSNSKPFDALAASLFDSTMKYPG* |
| Ga0182027_105412521 | 3300014839 | Fen | QSVVEEAASGAFIWLSDIKPSDAFAASLFNPFMKYAG* |
| Ga0182027_110757592 | 3300014839 | Fen | LQSVEEEAASGVFIGLSDIKPSDAFAASLFNPTVKYSG* |
| Ga0182027_111795611 | 3300014839 | Fen | VEEEAASGVFIGLSDIKPSDAFAASLFNPTVKYSG* |
| Ga0182027_116360272 | 3300014839 | Fen | RLQSVEEEAASGVFIWLSDIKPSDALAASLFNLSMKYAG* |
| Ga0182027_117636072 | 3300014839 | Fen | WRLQSVEEEAASGVFIWLSDIKPSDALAASLFNLSMKYAG* |
| Ga0187879_102568691 | 3300017946 | Peatland | NSIGWSLHSVLEEAVRLVFIGLSNSKPFDAPAASLFDSTMKYLG |
| Ga0187783_108906711 | 3300017970 | Tropical Peatland | QSVLEEAVMGVFIWLSDIKPFDASTASLFDRTMKYPG |
| Ga0181520_108667312 | 3300017988 | Bog | GSLQPVVEEAVPGVFIGLNNLKPLDALAASLVNPDMKYPG |
| Ga0187876_12722172 | 3300018003 | Peatland | SVAEEAASGIIIWLSDIKPSDAFAASLFNAIVRYPG |
| Ga0187860_100329314 | 3300018014 | Peatland | CSLQSVLEEAVSGVFIGLSVFKPSDAFAASLFNPIMTFPD |
| Ga0187872_100349065 | 3300018017 | Peatland | LQSVIEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG |
| Ga0187862_100423809 | 3300018040 | Peatland | SVVEEAASGAFIWLNNIKPSDAFAASLFNPFMKYAG |
| Ga0187773_108324062 | 3300018064 | Tropical Peatland | MGWRLQSVAQEAVSDVFIGLSVFKPSDALAASSFNSAMKYPG |
| Ga0194057_102907921 | 3300021072 | Anoxic Zone Freshwater | LQSVLEAAVGGVFIWLSVFKPSDAVAASLFNQIMTFPG |
| Ga0210378_100293282 | 3300021073 | Groundwater Sediment | GWSLQSVVEEAVSDVFIGLNDFKPSDSLAASLFNPTMKFPG |
| Ga0194043_12864081 | 3300021473 | Anoxic Zone Freshwater | SGVSLQSVLEAAVGGVFIWLSVFKPSDAVAASLFNQIMTFPG |
| Ga0212088_100237761 | 3300022555 | Freshwater Lake Hypolimnion | QSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG |
| Ga0212088_100337161 | 3300022555 | Freshwater Lake Hypolimnion | IGWWLQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG |
| Ga0212088_101257921 | 3300022555 | Freshwater Lake Hypolimnion | WLQSVAEEAVSRMFIWLSDFKPSDALAASLFNPSMNYAG |
| Ga0212088_103526021 | 3300022555 | Freshwater Lake Hypolimnion | SLQSVLEAAVGGVFIWLSVFKPSDAVAASLFNQIMTFPG |
| Ga0224552_10307221 | 3300022850 | Soil | QSVAEEAVSGVFMGMSDINPFDTLAASLFDPAMKYPG |
| Ga0224552_10527981 | 3300022850 | Soil | SNGSCLQSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPS |
| Ga0224558_10880332 | 3300023090 | Soil | WALQSVAEEAASGVFIWLSDIKPSDALAASLFNPIVIYPG |
| Ga0224558_11866542 | 3300023090 | Soil | DWALQSVAEEAASGVFIWLSDIKPSDALAASLFNPIVIYPG |
| Ga0209697_100658653 | 3300025316 | Freshwater Lake Hypolimnion | VSLQSVLEAAVGGVFIWLSVFKPSDAVAASLFNQIMTFPG |
| Ga0208820_10970421 | 3300025576 | Peatland | SVIEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG |
| Ga0209385_10152263 | 3300025650 | Arctic Peat Soil | IDGLNKEAASGVFIWLSDIKPSDAFAASLFNPSMKCPG |
| Ga0209429_102852432 | 3300025864 | Arctic Peat Soil | GWWLQSVVEEAVSRVFIWLSDIKPSDPLAASLFNPSMKYAG |
| Ga0207652_102793483 | 3300025921 | Corn Rhizosphere | SGCSLQSVAEEAVNGVFIWLSDIKPLDALAASSVNPLYEISGLER |
| Ga0256815_10416002 | 3300026463 | Sediment | MGCRLQSVVEEAVSRMFIGPNIFKPSDALAASLFNPSMNYAG |
| Ga0209388_11160572 | 3300027655 | Vadose Zone Soil | GCSLQSVAEEAVGGVFIWLSDIKPSDASAASLFSLTMKYPG |
| Ga0209450_103445912 | 3300027885 | Freshwater Lake Sediment | QSVLEEAVSRGFIRLNVFKPSDALAASLFNPSVKYCR |
| Ga0209777_101400984 | 3300027896 | Freshwater Lake Sediment | ALQSVIEEAVSRGLIWLCVFKPSDALAASSFNPSVKYYG |
| Ga0209777_103023661 | 3300027896 | Freshwater Lake Sediment | LQSVIEEAVSRGLIWLCVFKPSDALAASSFNPSVKYYG |
| Ga0209777_106195801 | 3300027896 | Freshwater Lake Sediment | SIACPLQSVLEEAVSRGFIWLNVYKPSDALAASLFNPSVKYYG |
| (restricted) Ga0233418_103348682 | 3300027995 | Sediment | MGWRLQSVVQEAVSDVFIGLSVFKPSDALAASSFNPAMKYPG |
| (restricted) Ga0233417_100819331 | 3300028043 | Sediment | SSGWCLQSVPEEAVNGVFIWLSDFKPSDALAASLFNSAMKYPG |
| Ga0265318_100436783 | 3300028577 | Rhizosphere | VAEEAVSGVFIRLSDIKPLDALAASSANTTMNYPG |
| Ga0311327_104023192 | 3300029883 | Bog | LQSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311361_100753317 | 3300029911 | Bog | SVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311361_106412861 | 3300029911 | Bog | GSCLQSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311359_101360264 | 3300029914 | Bog | CLQSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311358_102947451 | 3300029915 | Bog | QSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311363_1005391115 | 3300029922 | Fen | CLLSVVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311346_113474481 | 3300029952 | Bog | VVQEAVSGVFIWLSDIKPSDALAASLFNLAMKYPG |
| Ga0311331_111377351 | 3300029954 | Bog | SCLQSVAQEAVSGVFIWLSDIKPMDALAASLVNPIMKYPG |
| Ga0302275_104147422 | 3300030518 | Bog | ALQSVAEEAVNGVFIWLSDIKPSDPFAASLFNPAMKYPG |
| Ga0265316_101242282 | 3300031344 | Rhizosphere | VLEEAVNGVFIWLSDIKPFDPLAASLFDPTMKYPG |
| Ga0302320_101918811 | 3300031524 | Bog | QSVAQEAVSGVFIWLSDIKPMDALAASLVNPIMKYPG |
| Ga0302320_111429923 | 3300031524 | Bog | SGDSLQSVAEEAVSGVFIWLSDIKPFDALAASLFDSTMKFPG |
| Ga0307373_106288222 | 3300031672 | Soil | VGEEAVSGVFIWLSDIKPSDALAASLFNPAMKFPG |
| Ga0302321_1006488591 | 3300031726 | Fen | WALQSVLEEAVSRGFIWLSVYKPSDAFAASLFNPAMKYAG |
| Ga0315288_100621751 | 3300031772 | Sediment | SVGEEAVSVVFIGLNVFKPSDSHAASSFNPAMKYPG |
| Ga0302322_1019291301 | 3300031902 | Fen | IAWALQSVLEEAVSRGFIWLSVYKPSDALAASLFNPSMKYAG |
| Ga0315295_101791111 | 3300032156 | Sediment | KSIGWRLQSVVEEAVSRVFIWLSDIKPSDALAASLFNPSVNYAG |
| Ga0315295_114271952 | 3300032156 | Sediment | GWRLQSVAEEAVSRVFIWLSDFKPYDALAASLFNTSMNYAG |
| Ga0307471_1036215171 | 3300032180 | Hardwood Forest Soil | WFLHSVEEEAVGGNFIWLSKFKPYDASTASLFNPRMKYPG |
| Ga0315270_104696522 | 3300032275 | Sediment | SVEEEAASGVFIGLSDIKPSDAFAASLFNSTMKYPG |
| Ga0315275_100378661 | 3300032401 | Sediment | SLQSVLEEAASRGFIWLSVFKPSDALAASLFNPIMNFPG |
| Ga0315273_105774321 | 3300032516 | Sediment | GCRLQSVVEEAVSRVFIWLSDFKPSDALAASLFNPSVKFAG |
| Ga0335074_102779803 | 3300032895 | Soil | CSLQSVVEEAACGDFIWLSEIKPMDAPAASLVNPFMKYPG |
| Ga0335074_107423972 | 3300032895 | Soil | QSVEEEAVSGIFIWLSDFKPSDPLAASLFNPAMKYPG |
| Ga0335075_1000236728 | 3300032896 | Soil | SLQSVVEEAACGVFIWLSEIKPMDAPAASLVNPFMKYPG |
| Ga0335075_1001302810 | 3300032896 | Soil | SVVEEAACGVFIWLSEIKPMDAPAASLVNPFMKYPG |
| Ga0316620_103852311 | 3300033480 | Soil | MGWRLQSVAEEAVSDVFIGLNNFKPSDALAASSFNSAMKYPG |
| Ga0316621_113716202 | 3300033488 | Soil | MGWRRQSVGEEAVSALFIGLNVFKPSDALAASSFNSAMNFPG |
| Ga0334837_017263_1_114 | 3300033823 | Soil | QSVAEEAASGIIIWLSDIKPSDAFAASLFNAIVRYPG |
| Ga0334837_070621_1_120 | 3300033823 | Soil | ALQSVAEEAASGIIIWLSDIKPSDAFAASLFNAIVRYPG |
| ⦗Top⦘ |