


| Basic Information | |
|---|---|
| Family ID | F092819 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSAPSVQVETRGAVALVTLNRPESANTLNLQMAMDLLAA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.26 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 85.98 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.393 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 20.90% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00111 | Fer2 | 66.36 |
| PF02567 | PhzC-PhzF | 14.02 |
| PF07615 | Ykof | 6.54 |
| PF07690 | MFS_1 | 3.74 |
| PF01636 | APH | 3.74 |
| PF00144 | Beta-lactamase | 1.87 |
| PF00355 | Rieske | 1.87 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 14.02 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.39 % |
| Unclassified | root | N/A | 5.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2029527000|GBANfinal_contig55608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2429501 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300000955|JGI1027J12803_101233658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300005334|Ga0068869_102011130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sanxanigenens | 519 | Open in IMG/M |
| 3300005434|Ga0070709_11084199 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005436|Ga0070713_102346273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300005459|Ga0068867_100878379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300005540|Ga0066697_10392238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300005541|Ga0070733_10960959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300005544|Ga0070686_100305650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300005559|Ga0066700_10012576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4462 | Open in IMG/M |
| 3300005564|Ga0070664_100023340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5109 | Open in IMG/M |
| 3300005598|Ga0066706_10402347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300005764|Ga0066903_101339850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300005841|Ga0068863_100889050 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006163|Ga0070715_10012555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3087 | Open in IMG/M |
| 3300006354|Ga0075021_10281371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300009012|Ga0066710_102192116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 807 | Open in IMG/M |
| 3300009174|Ga0105241_11679630 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009545|Ga0105237_10970265 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300010043|Ga0126380_11985533 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010048|Ga0126373_10865401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300010358|Ga0126370_10997904 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010379|Ga0136449_101948123 | Not Available | 871 | Open in IMG/M |
| 3300010397|Ga0134124_11947483 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010401|Ga0134121_10049715 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300010864|Ga0126357_1333620 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011120|Ga0150983_14722067 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012203|Ga0137399_10452244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1074 | Open in IMG/M |
| 3300012357|Ga0137384_10436523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1079 | Open in IMG/M |
| 3300012469|Ga0150984_116720330 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012685|Ga0137397_10357944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300012927|Ga0137416_10543412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300012989|Ga0164305_10009802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4567 | Open in IMG/M |
| 3300014325|Ga0163163_12402818 | Not Available | 585 | Open in IMG/M |
| 3300016357|Ga0182032_11605347 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300016404|Ga0182037_10046892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2863 | Open in IMG/M |
| 3300017553|Ga0182744_1249222 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017927|Ga0187824_10143796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 788 | Open in IMG/M |
| 3300017930|Ga0187825_10198612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 721 | Open in IMG/M |
| 3300017937|Ga0187809_10329387 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300017961|Ga0187778_10176182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1356 | Open in IMG/M |
| 3300017966|Ga0187776_10460326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300017970|Ga0187783_11386554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300017972|Ga0187781_11068204 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300017973|Ga0187780_10041658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3208 | Open in IMG/M |
| 3300018429|Ga0190272_12600787 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018431|Ga0066655_10016723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3331 | Open in IMG/M |
| 3300020581|Ga0210399_11484005 | Not Available | 527 | Open in IMG/M |
| 3300021168|Ga0210406_10853620 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021178|Ga0210408_11085237 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021181|Ga0210388_11070306 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021401|Ga0210393_10167063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1772 | Open in IMG/M |
| 3300021402|Ga0210385_11375011 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021404|Ga0210389_11558827 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021407|Ga0210383_10265527 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300022530|Ga0242658_1223425 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300023079|Ga0247758_1043482 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300023267|Ga0247771_1150695 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300023270|Ga0247784_1016326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1725 | Open in IMG/M |
| 3300025325|Ga0209341_10346798 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300025903|Ga0207680_11374488 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025914|Ga0207671_10518022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 951 | Open in IMG/M |
| 3300025928|Ga0207700_11779706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300025941|Ga0207711_10436724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1218 | Open in IMG/M |
| 3300026298|Ga0209236_1146913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1002 | Open in IMG/M |
| 3300026555|Ga0179593_1143729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2141 | Open in IMG/M |
| 3300026555|Ga0179593_1779399 | Not Available | 1421 | Open in IMG/M |
| 3300027459|Ga0207505_103794 | Not Available | 939 | Open in IMG/M |
| 3300027648|Ga0209420_1199991 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027889|Ga0209380_10347916 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027986|Ga0209168_10192922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1021 | Open in IMG/M |
| 3300028906|Ga0308309_11604536 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300029999|Ga0311339_11509956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. OK085 | 598 | Open in IMG/M |
| 3300030058|Ga0302179_10110158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300030739|Ga0302311_10152308 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300031057|Ga0170834_104704038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300031128|Ga0170823_14938672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 884 | Open in IMG/M |
| 3300031616|Ga0307508_10303657 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300031713|Ga0318496_10641694 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031723|Ga0318493_10107952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1404 | Open in IMG/M |
| 3300031723|Ga0318493_10723642 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031740|Ga0307468_100921611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 760 | Open in IMG/M |
| 3300031744|Ga0306918_11512356 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031748|Ga0318492_10146352 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300031751|Ga0318494_10239231 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031764|Ga0318535_10542869 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031768|Ga0318509_10056355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2020 | Open in IMG/M |
| 3300031770|Ga0318521_10265342 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031833|Ga0310917_10147178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1552 | Open in IMG/M |
| 3300031835|Ga0318517_10201803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300031845|Ga0318511_10071545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1434 | Open in IMG/M |
| 3300031890|Ga0306925_11136212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 787 | Open in IMG/M |
| 3300031894|Ga0318522_10345341 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031945|Ga0310913_10347605 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031947|Ga0310909_11059421 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031962|Ga0307479_11106414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 758 | Open in IMG/M |
| 3300032041|Ga0318549_10021305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2457 | Open in IMG/M |
| 3300032059|Ga0318533_10250879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1277 | Open in IMG/M |
| 3300032261|Ga0306920_100276160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2505 | Open in IMG/M |
| 3300032770|Ga0335085_10073137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4527 | Open in IMG/M |
| 3300032783|Ga0335079_11633529 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032828|Ga0335080_10204074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2173 | Open in IMG/M |
| 3300032892|Ga0335081_10487240 | Not Available | 1556 | Open in IMG/M |
| 3300032898|Ga0335072_10940510 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300032955|Ga0335076_10057851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3833 | Open in IMG/M |
| 3300033475|Ga0310811_11456082 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Green-Waste Compost | Engineered → Solid Waste → Grass → Composting → Bioreactor → Green-Waste Compost | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2029527000 | Green-waste compost microbial community at University of California, Davis, USA, from solid state bioreactor - Inoculum 16S MiniPCR | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017553 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300023267 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L197-509C-6 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GBAN_1578580 | 2029527000 | Green-Waste Compost | MSTPTVNVETRGAVALVTLNRPDVSNTLNLQVAMDLLA |
| ICChiseqgaiiDRAFT_24295011 | 3300000033 | Soil | MSAPTVEVQSRGAVAIVTINRPEVSNTLNLQTAMDLL |
| JGI1027J12803_1012336581 | 3300000955 | Soil | MSAPVVQVETRGAVALVILNRPESGNALNLQVAMDLLAAAMTCARNAAV |
| Ga0068869_1020111302 | 3300005334 | Miscanthus Rhizosphere | MSAPTVQVESRGAVTVVTLNRPDSSNTLNIQMAMDLLAAAMT |
| Ga0070709_110841991 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAPCVQVETRGTVAVVTLNRPDTSNAINLQTAMDLLAAAMTCARNNT |
| Ga0070713_1023462732 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTPSVQVETRGAVALVTLNRPDGANTLNLEMAMDLLAAAMTCGR |
| Ga0068867_1008783791 | 3300005459 | Miscanthus Rhizosphere | MSTTTVEVESRGAVAVVTINRPESGNALSLEVGMDLMAAA |
| Ga0066697_103922383 | 3300005540 | Soil | MAAATVEVETRGAVAIVTLNRPQSANTLNLQMAMDL |
| Ga0070733_109609592 | 3300005541 | Surface Soil | MAAPAVQVETRGAVALVTLNRPDSGNALNLQMAMDLMAA |
| Ga0070686_1003056503 | 3300005544 | Switchgrass Rhizosphere | MSAPLVEMETRGSVAVITLNRPDLSNTLNLQMAMDLLAAAMTCGRNSAVR |
| Ga0066700_100125761 | 3300005559 | Soil | MAAASVEVETRGAVALVTLNRPESANTLNLQMAMDLLAAAMTCARN |
| Ga0070664_1000233401 | 3300005564 | Corn Rhizosphere | MSTSSVQVDTRGAVAVVTLNRPESSNTLNLEMAMDLLAAAMTCGRNPA |
| Ga0066706_104023471 | 3300005598 | Soil | MAPASVEVETRGAVALVTLNRPQSSNTLNLRMAMDLLAAAMT |
| Ga0066903_1013398504 | 3300005764 | Tropical Forest Soil | MSAPAVQVETRGAVALVTLNRPESGNALNLQVAMDLLA |
| Ga0068863_1008890501 | 3300005841 | Switchgrass Rhizosphere | MSAPTVQVESRGAVAIVTINRPEVSNTLNLQTAMDLLAAAMTCGRN |
| Ga0070715_100125551 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAPTVQVETRGAVALVTLNRPENANTLNLQMAMD |
| Ga0075021_102813711 | 3300006354 | Watersheds | VSTSSVQVETRGAVALVTLNRPESANTLNLEMAMDLLAAALTCARN |
| Ga0066710_1021921163 | 3300009012 | Grasslands Soil | MAAASVEVETRGAVALVTLNRPESANTLNLQMAMDLL |
| Ga0105241_116796301 | 3300009174 | Corn Rhizosphere | MSAPLVEMETRGSVAVITLNRPDLSNTLNLQMAMDLLAAAMTCGRNS |
| Ga0105237_109702651 | 3300009545 | Corn Rhizosphere | MSTSSVQVETRGAVAVVTLNRPDSSNTLNLEMAMDLLAAAMTCG |
| Ga0126380_119855331 | 3300010043 | Tropical Forest Soil | MATVTVEVETRGPVALVTLNRPDSANTLNLQVAMDLL |
| Ga0126373_108654011 | 3300010048 | Tropical Forest Soil | VSAANVQVETRGAVALVTLNRPEHSNTLNLQLAMDLLAA |
| Ga0126370_109979041 | 3300010358 | Tropical Forest Soil | MSAPSVQAETHGAVALVTLNRPEHSNTLNLQMAMDLLAAAMACARN |
| Ga0136449_1019481233 | 3300010379 | Peatlands Soil | MSAPSVQVETHGAVALVTLNRPEHSNTLNLQMAMDLLAAAMACAR |
| Ga0134124_119474831 | 3300010397 | Terrestrial Soil | MSAPTVQVESRGAVTVVTLNRPDSSNTLNIQMAMDLL |
| Ga0134121_100497156 | 3300010401 | Terrestrial Soil | MSAPVVQVETRGAVALVILNRPESGNALNLQVAMDLLAA |
| Ga0126357_13336202 | 3300010864 | Boreal Forest Soil | MSTSSVQVETRGAVALVTLNRPDSANTFNLEMAMDLLAAAM |
| Ga0150983_147220673 | 3300011120 | Forest Soil | MSAPVVQVDTRGAVALVTLNRPDSGNALNLQVAMDLLAAAMTCAR |
| Ga0137399_104522441 | 3300012203 | Vadose Zone Soil | MAAASIEVETRGAVALVTLNRPESANTLNLQMAMDL |
| Ga0137384_104365231 | 3300012357 | Vadose Zone Soil | MAAATVEVETRGAVAVVTLNRPQSANTLNLQMAMDLLAAAMACA |
| Ga0150984_1167203302 | 3300012469 | Avena Fatua Rhizosphere | MSAPTVQVESRGAVAIVTINRPDVSNTLNLQTAMDLLAAAMTCGRNSGVR |
| Ga0137397_103579441 | 3300012685 | Vadose Zone Soil | MSTPSVQVETRGPVALVRLNRPESSNAINLQMAMDLLAAAMTC |
| Ga0137416_105434123 | 3300012927 | Vadose Zone Soil | MAAASIEVETRGAVALVTLNRPESANTLNLQMAMDLLAAAMTCARNAA |
| Ga0164305_100098021 | 3300012989 | Soil | VSAPTVQVETRGAVALVTLNRPENANTLNLQMAMDLLAAALACARNAAV |
| Ga0163163_124028181 | 3300014325 | Switchgrass Rhizosphere | MSTPSVQVETRGAVALVTLNRPDSANTLNLETAMDLLAAAMTCARNPA |
| Ga0182032_116053471 | 3300016357 | Soil | MSAPAVQVETRGAVALVTLNRPESGNAINLQVAMDLLAAAMT |
| Ga0182037_100468926 | 3300016404 | Soil | MSAPAVQVETRGAVALVTLNRPESGNALNLQVAMDLLAAAMT |
| Ga0182744_12492222 | 3300017553 | Compost | MSAETVEVESRGAVAIVTINRPDASNTLNLQTAMDLLAAAMTCGRNSAV |
| Ga0187824_101437963 | 3300017927 | Freshwater Sediment | MSAPSVQVETRGAVALVTLNRPESGNALNLRMAMDLLAAAMTCAR |
| Ga0187825_101986121 | 3300017930 | Freshwater Sediment | MSAPSVQVETRGAVALVTLNRPESGNALNLRMAMDLLAAAMT |
| Ga0187809_103293871 | 3300017937 | Freshwater Sediment | MSAPSVQVETRGAVALVTLNRPESGNALNLRMAMDLL |
| Ga0187778_101761821 | 3300017961 | Tropical Peatland | MSASTVSVDTRGAVAIITLNRPDNANTLNLQMGMDLLA |
| Ga0187776_104603261 | 3300017966 | Tropical Peatland | VSVPSVQLETRGAVALVTLNRPDHSNTLNLQMAMDLLAAAMAC |
| Ga0187783_113865541 | 3300017970 | Tropical Peatland | VSAPSVQVETRGAVALVTLNRPDNGNAINLQMAMDLLAAALTCAGNTSVR |
| Ga0187781_110682042 | 3300017972 | Tropical Peatland | MAAPAVQVETRGAVALVTLNRPDSGNALNLQMAMDLLA |
| Ga0187780_100416581 | 3300017973 | Tropical Peatland | MSAASVQVETHGAVALVTLNRPEHSNTLNLQMAMDLLAAAMACARNAAVRA |
| Ga0190272_126007871 | 3300018429 | Soil | MSTSTIDVETRGAVALVTINRPDSSNTLNLQVAMDLLAAA |
| Ga0066655_100167231 | 3300018431 | Grasslands Soil | MAAATVEVETRGAVALVTLNRPESANTLNLQMAMDLLAAAMTCARNAA |
| Ga0210399_114840052 | 3300020581 | Soil | MSAPSVQVETHGAVALVTLNRPEHSNTLNLQMAMDLLA |
| Ga0210406_108536201 | 3300021168 | Soil | MSTSSVQVETRGAVALVTLNRPDSSNTLNLEMAMDLLAAAMTCGRNPA |
| Ga0210408_110852372 | 3300021178 | Soil | VSTASVQVETHGAVALVRLNRPEHANTLNLQMAMDLLAAAMACAR |
| Ga0210388_110703063 | 3300021181 | Soil | VAAPTVQVETRGAVALVTLNRPESANTLNLQMGMDLLAAALACA |
| Ga0210393_101670631 | 3300021401 | Soil | VAAPTVQVETRGAVALVTLNRPESANTLNLQMGMDLLAAALAC |
| Ga0210385_113750111 | 3300021402 | Soil | MSAPTVQVETRGAVALVTLNRPDSANTLNLQMAMDLLA |
| Ga0210389_115588271 | 3300021404 | Soil | VSAPTVQVETRGAVALVTLNRPESANTLNLQMGMDLLAAAL |
| Ga0210383_102655271 | 3300021407 | Soil | MSAPSVQVETHGAVALVTLNRPEHSNTLNLQMAMDLLAAAMAC |
| Ga0242658_12234252 | 3300022530 | Soil | MSAPNVHVETRGPVALISLNRPESANTINLQTAMDLLAA |
| Ga0247758_10434823 | 3300023079 | Plant Litter | MSAPSVQVESRGAVAVVTINRPDVSNTLNLQTAMDLLAA |
| Ga0247771_11506952 | 3300023267 | Plant Litter | MSAPSVQVESRGAVAVVTINRPDVSNTLNLQTAMDL |
| Ga0247784_10163264 | 3300023270 | Plant Litter | MSAPTVQVESRGPVAVITLNRPDVSNTLNLQTAMDLLAAAMTCGRNSAV |
| Ga0209341_103467983 | 3300025325 | Soil | MSQSTVNVETRGAVALVTIDRPDDANTLNVQVGMD |
| Ga0207680_113744881 | 3300025903 | Switchgrass Rhizosphere | MSTSSVQVETRGAVAVVTLNRPESSNTLNLEMAMDLLAAAM |
| Ga0207671_105180223 | 3300025914 | Corn Rhizosphere | MSAPSVQVETRGRVALVTLNRPDSSNTINLQMAMDLLAAAM |
| Ga0207700_117797062 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTPSVQVETRGAVALVTLNRPDGANTLNLEMAMDLLAAAMTCGRNP |
| Ga0207711_104367241 | 3300025941 | Switchgrass Rhizosphere | VSAPTVQVETRGAVALVTLNRPENANTLNLQMAMDLLAAALACARNAAVR |
| Ga0209236_11469131 | 3300026298 | Grasslands Soil | MAAATVEVETRGAVAVVTLNRPQSANTLNLQMAMDLLAAAMTC |
| Ga0179593_11437291 | 3300026555 | Vadose Zone Soil | MAPASVEVETRGAVALVTLNRPQSSNTLNLQMAMDLLAAAMTCA |
| Ga0179593_17793991 | 3300026555 | Vadose Zone Soil | MAPASVEVRTRGAVAMGTLKPHAAPKRPLQMSMDLLAAAMTCAATPR |
| Ga0207505_1037942 | 3300027459 | Soil | VAAPSVQVETRGAVALVTLNRPDSANTLNLQMAMDLLA |
| Ga0209420_11999911 | 3300027648 | Forest Soil | MSTATVNVETRGAVAVVTLNRPAQSNTLSLQMGMDLLAA |
| Ga0209380_103479163 | 3300027889 | Soil | MATATVEVETQGAVALVTLNRPDSNNTLNLQMAMDLLAAS |
| Ga0209168_101929221 | 3300027986 | Surface Soil | MSVPSVQVETRGPVALVTLNRPDSANTINLQMAMDL |
| Ga0308309_116045362 | 3300028906 | Soil | MSTATVDVETRGAVAIVTLNRPAQSNTLSLQMGMDLLAAAMTCARSTAV |
| Ga0311339_115099561 | 3300029999 | Palsa | MTNSSVYVETSGAAALVTLNRPDSANTLDLQAAMDLLSVAMTCARNPTVRV |
| Ga0302179_101101581 | 3300030058 | Palsa | MSTATVDVETRGAVAIVTLNRPAQSNTLSLQMGMDLLAAAMTCARS |
| Ga0302311_101523081 | 3300030739 | Palsa | MSAPTVQVETRGPVALVRLNRPESSNAINLQMAMDLLAAAMT |
| Ga0170834_1047040383 | 3300031057 | Forest Soil | VSTASVQVETHGAVALVTLNRPEHSNTLNLQMARA |
| Ga0170823_149386721 | 3300031128 | Forest Soil | MSTPSVQVETRGAVALVTLNRPESANTLNLQMGMDL |
| Ga0307508_103036574 | 3300031616 | Ectomycorrhiza | MSTPSVQVETRGPVALVRLNRPESSNTINLQMAMDLLAAAMTCARNNNV |
| Ga0318496_106416942 | 3300031713 | Soil | VSAPTVQVETRGSVALVTFNRPESGNTLNLQMAMDLLAAAMTCARNAA |
| Ga0318493_101079521 | 3300031723 | Soil | MSAPAVQVETRGAVALVTLNRPESGNALNLQVAMDLLAAAMTCARN |
| Ga0318493_107236421 | 3300031723 | Soil | MSAPAVQVETHGAVALVILNRPESGNAINLQVAMDLL |
| Ga0307468_1009216111 | 3300031740 | Hardwood Forest Soil | VSAPTVQVETRGAVALVTLNRPENANTLNLQMAMDL |
| Ga0306918_115123561 | 3300031744 | Soil | MSAPAVQVETRGAVALVTLNRPESGNALNLQVAMDLLAAAM |
| Ga0318492_101463524 | 3300031748 | Soil | MSAPAVQVETRGAVALVILNRPESGNALNLRVAMDLLAAAMTCARNAA |
| Ga0318494_102392314 | 3300031751 | Soil | MSAPAVQVETRGAVALVILDRPESGNALNLQVAMDLLA |
| Ga0318535_105428692 | 3300031764 | Soil | MSAATVQVETHGAVALVTLNRPDNSNTLNLQMAMDLLAAALTCARNAAVR |
| Ga0318509_100563551 | 3300031768 | Soil | MSAPVVQVETRGAVALVTLNRPESGNALNLQVAMDLL |
| Ga0318521_102653421 | 3300031770 | Soil | VSAPTVQVETRGSVALVTFNRPESGNTLNLQMAMDLLAA |
| Ga0310917_101471781 | 3300031833 | Soil | MSAPAVQVETRGAVALVTLNRPESGNALNLQVAMDLL |
| Ga0318517_102018031 | 3300031835 | Soil | MSAPAVQVETHGAVALVILNRPESGNAINLQVAMDLLAAAMTCARN |
| Ga0318511_100715451 | 3300031845 | Soil | MSAPAVQVETHGAVALVILNRPESGNAINLQVAMDLLAAAMTCARNAAVRA |
| Ga0306925_111362121 | 3300031890 | Soil | MSAPAVQVETRGAVALVILNRPESGNALNLQVAMD |
| Ga0318522_103453411 | 3300031894 | Soil | MSAPAVQVETRGAVALVILNRPESGNALNLRVAMDLL |
| Ga0310913_103476054 | 3300031945 | Soil | MSAPAVQVETRGAVALVILNRPESGNALNLRVAMDLLAAAMTC |
| Ga0310909_110594211 | 3300031947 | Soil | MSAPAVQVETRGAVALVTLNRPESGNAINLQVAMDLLAAAMTCARNAAVR |
| Ga0307479_111064143 | 3300031962 | Hardwood Forest Soil | MSAPVVQVDTRGAVALVTLNRPDSGNALNLQVAMDL |
| Ga0318549_100213055 | 3300032041 | Soil | MSAPAVQVETHGAVALVILNRPESGNAINLQVAMDLLAAAMTCARNAAVR |
| Ga0318533_102508794 | 3300032059 | Soil | MSAPVVQVETRGAVALVTLNRPDSGNALNLQVAMDLLAAA |
| Ga0306920_1002761601 | 3300032261 | Soil | MSAPAVQVETRGAVALVILNRPDSGNALNLQVAMDLLAAAMT |
| Ga0335085_100731377 | 3300032770 | Soil | MSAPSVQVETRGAVALVTLSRPESANTLNLQMAMDLLAAAL |
| Ga0335079_116335293 | 3300032783 | Soil | MSASTVEVDTRGAVTIITLNRPDDGNALNLQMGMD |
| Ga0335080_102040745 | 3300032828 | Soil | MSAPSVQVETRGAVALVTLNRPESANTLNLQMGMDLLAAALACARNAEVR |
| Ga0335081_104872404 | 3300032892 | Soil | MSAPSVQVETRGAVALVTLNRPESANTLNLQMAMDLLAA |
| Ga0335072_109405101 | 3300032898 | Soil | MSAPCVHVETRGPVALVRLNRPESANTIDLQTAMDLLAAAMTCSRN |
| Ga0335076_100578511 | 3300032955 | Soil | VSVASVQVETHGAVALVTLNRPEHSNTLNLQMAMDLLAAA |
| Ga0310811_114560821 | 3300033475 | Soil | MSAPSVQVETRGPVALVTLNRPESSNTLNLQMAMDLLAA |
| ⦗Top⦘ |