


| Basic Information | |
|---|---|
| Family ID | F092812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LGSHFGFHGQRVETRAELEGALQGALAATKGGKTAILNVMVSR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 94.39 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.196 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 16.90% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 79.25 |
| PF00152 | tRNA-synt_2 | 7.55 |
| PF11794 | HpaB_N | 0.94 |
| PF00043 | GST_C | 0.94 |
| PF13416 | SBP_bac_8 | 0.94 |
| PF13183 | Fer4_8 | 0.94 |
| PF00903 | Glyoxalase | 0.94 |
| PF01976 | DUF116 | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 79.25 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.55 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.55 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 7.55 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 7.55 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.94 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1852 | Predicted redox protein with CxxCxxC motif, DUF116 family | General function prediction only [R] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.20 % |
| Unclassified | root | N/A | 2.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02IR62G | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300001081|JGI12662J13196_1016430 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300001431|F14TB_100307670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1104 | Open in IMG/M |
| 3300005185|Ga0066811_1014401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300005332|Ga0066388_103027920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300005332|Ga0066388_108549997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300005343|Ga0070687_100156498 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300005437|Ga0070710_10806638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005444|Ga0070694_100042423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3039 | Open in IMG/M |
| 3300005554|Ga0066661_10290830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1007 | Open in IMG/M |
| 3300005617|Ga0068859_101153525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300005764|Ga0066903_100940430 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300005764|Ga0066903_102493062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. CF080 | 1001 | Open in IMG/M |
| 3300005764|Ga0066903_103514535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300006028|Ga0070717_10373974 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300006028|Ga0070717_10659439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300006028|Ga0070717_11703132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300006051|Ga0075364_10547597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. CF080 | 791 | Open in IMG/M |
| 3300006163|Ga0070715_10050829 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300006577|Ga0074050_12001445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300006847|Ga0075431_100338821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1513 | Open in IMG/M |
| 3300006847|Ga0075431_101116575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300006854|Ga0075425_102629939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300006904|Ga0075424_101450516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300007076|Ga0075435_100799923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300009088|Ga0099830_10022628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4119 | Open in IMG/M |
| 3300009156|Ga0111538_12281462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300009792|Ga0126374_11711520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300010321|Ga0134067_10220611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300010337|Ga0134062_10089196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1310 | Open in IMG/M |
| 3300010359|Ga0126376_12099812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300010360|Ga0126372_10637132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300010362|Ga0126377_10627467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300010362|Ga0126377_13563622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300010375|Ga0105239_13510082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300010376|Ga0126381_101115217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1140 | Open in IMG/M |
| 3300010376|Ga0126381_101516682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 969 | Open in IMG/M |
| 3300010376|Ga0126381_102260245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300010398|Ga0126383_11307854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300010398|Ga0126383_11563556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300010398|Ga0126383_12475556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300010868|Ga0124844_1146950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300011106|Ga0151489_1723365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 612 | Open in IMG/M |
| 3300012070|Ga0153963_1060156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300012203|Ga0137399_11061125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300012206|Ga0137380_11423888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300012207|Ga0137381_10628495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300012351|Ga0137386_11013056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300012908|Ga0157286_10331185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300012957|Ga0164303_10089330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1494 | Open in IMG/M |
| 3300012984|Ga0164309_10960027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300012988|Ga0164306_10794124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300015359|Ga0134085_10261157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300016294|Ga0182041_12008263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300016319|Ga0182033_11085073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300016357|Ga0182032_10910959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
| 3300016422|Ga0182039_11012080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300016744|Ga0183099_1258248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300016744|Ga0183099_1258248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300017965|Ga0190266_11353881 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300018058|Ga0187766_10751861 | Not Available | 677 | Open in IMG/M |
| 3300018071|Ga0184618_10477218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 524 | Open in IMG/M |
| 3300018082|Ga0184639_10481900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300020579|Ga0210407_10161763 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300021418|Ga0193695_1045373 | Not Available | 954 | Open in IMG/M |
| 3300021560|Ga0126371_13940512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300022534|Ga0224452_1006462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2909 | Open in IMG/M |
| 3300022883|Ga0247786_1063666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300025898|Ga0207692_10590474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300025919|Ga0207657_10811261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300025932|Ga0207690_10124264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1879 | Open in IMG/M |
| 3300025939|Ga0207665_10017030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4774 | Open in IMG/M |
| 3300025965|Ga0210090_1025710 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300026319|Ga0209647_1214560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300026490|Ga0257153_1044212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300027862|Ga0209701_10081653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2037 | Open in IMG/M |
| 3300028714|Ga0307309_10032122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300028755|Ga0307316_10059878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1289 | Open in IMG/M |
| 3300028778|Ga0307288_10446057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300028811|Ga0307292_10241871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 748 | Open in IMG/M |
| 3300028875|Ga0307289_10157200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300031199|Ga0307495_10013205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1262 | Open in IMG/M |
| 3300031561|Ga0318528_10419453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300031680|Ga0318574_10674109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300031719|Ga0306917_11570084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300031720|Ga0307469_10875139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300031724|Ga0318500_10339515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300031740|Ga0307468_100024041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2763 | Open in IMG/M |
| 3300031747|Ga0318502_10091389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1674 | Open in IMG/M |
| 3300031748|Ga0318492_10671454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300031768|Ga0318509_10395888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300031779|Ga0318566_10481251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300031780|Ga0318508_1226539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300031781|Ga0318547_10455036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| 3300031781|Ga0318547_10932893 | Not Available | 542 | Open in IMG/M |
| 3300031782|Ga0318552_10395421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300031805|Ga0318497_10867693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031821|Ga0318567_10491785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 696 | Open in IMG/M |
| 3300031835|Ga0318517_10043115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1866 | Open in IMG/M |
| 3300031880|Ga0318544_10344836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300031890|Ga0306925_12184530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300031942|Ga0310916_10242793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1516 | Open in IMG/M |
| 3300031951|Ga0315904_10983500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 671 | Open in IMG/M |
| 3300031959|Ga0318530_10332719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 628 | Open in IMG/M |
| 3300032059|Ga0318533_11012201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300032059|Ga0318533_11319751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300033290|Ga0318519_10456923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Bioreactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012070 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016744 | Microbial communities from bioreactor (seeded with anoxic lake sediment) at LBNL, California, USA - Biofuel metagenome 1 | Engineered | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_00657300 | 2170459013 | Grass Soil | FGFHGARVETLAELKGALQTALAATKAGKTAILNVHVNR |
| JGI12662J13196_10164301 | 3300001081 | Forest Soil | EGPDYAELGSHFGFHGARVEKLGALKGALKSALAATKDGKTYLLNVVLTR* |
| F14TB_1003076701 | 3300001431 | Soil | LGSHFGFHGERVEYRAELEIALRSALAATKEGKTAILNVLLSR* |
| Ga0066811_10144012 | 3300005185 | Soil | DYEQLGSHFGFHGARVEILAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0066388_1030279201 | 3300005332 | Tropical Forest Soil | GASASKDLHFGVTIEGPEYAELGSHFGFHGQRVEKLAELKGALAAALAATKAGKTSILNVVVTR* |
| Ga0066388_1085499972 | 3300005332 | Tropical Forest Soil | LGSHFGFHGQRVENRAELEGALQNALAATRGGKTAILNVLLSR* |
| Ga0070687_1001564983 | 3300005343 | Switchgrass Rhizosphere | FGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0070710_108066382 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGSHFGFHGQRVEKLAELKGALASALAATKAGKTSILNVVVTR* |
| Ga0070694_1000424234 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GSHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0066661_102908301 | 3300005554 | Soil | AMRQGHVHHYPDGASASENLHYGVTIDGPNYEQLGGHFGFHGQRVEKVGELNRALRDALAAANGGRTAILNACVTR* |
| Ga0068859_1011535251 | 3300005617 | Switchgrass Rhizosphere | GFHGARVETLAELKGALQAGLAAIKAGKTAILNVHVNR* |
| Ga0066903_1009404301 | 3300005764 | Tropical Forest Soil | ELGSHFGFHGARVEKRADLPGALKGALAATKDGRTAILNVMVNQ* |
| Ga0066903_1024930622 | 3300005764 | Tropical Forest Soil | LGSHFGFHGQRVETRAELEGALQGALAATKGGKTAILNVMVSR* |
| Ga0066903_1035145352 | 3300005764 | Tropical Forest Soil | HFGFHGERVEYRAELEIALKSALAAMKEGRTAILNVMASR* |
| Ga0070717_103739741 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0070717_106594391 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FHGQRVEKLGDLKGALQGALAANKGSKTAILNVMVTR* |
| Ga0070717_117031321 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FGFHGQRVENRAELDGALQSALAATKGGKTAILNVVVSR* |
| Ga0075364_105475972 | 3300006051 | Populus Endosphere | LAALRGGERVEKLADLKGALQKALAATKSGKTAILNVVVTR* |
| Ga0070715_100508291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PDYEQLAGHFGFHGQRVEKSAELPGALRGALAAMKDGRTAIVNACVTQ* |
| Ga0074050_120014452 | 3300006577 | Soil | FHGARVETLAELKEAIQAALSATKAGKTAILNVHVSR* |
| Ga0075431_1003388211 | 3300006847 | Populus Rhizosphere | RLGSHFGFHGERVEKLADLEGALQKALAATKSGKTAILNVVVTR* |
| Ga0075431_1011165751 | 3300006847 | Populus Rhizosphere | YEQLGSHFGFHGQRVEKLDEVKGALQKALAAVQGGKTAILNVVVSR* |
| Ga0075425_1026299391 | 3300006854 | Populus Rhizosphere | GSHFGFQGQRVEKLADLKGALQGALAANKGGKTAILNVMLTR* |
| Ga0075424_1014505162 | 3300006904 | Populus Rhizosphere | ARVETLAELKDAIQAALAATKAGKTAILNVHVSR* |
| Ga0075435_1007999231 | 3300007076 | Populus Rhizosphere | PDYEQLGSHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0099830_100226285 | 3300009088 | Vadose Zone Soil | FGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSH* |
| Ga0111538_122814621 | 3300009156 | Populus Rhizosphere | ELHFGVTIDGPDYESLGSHFGFHGQRVENRAELATALTRALAATREGRTAILNAVVTR* |
| Ga0126374_117115202 | 3300009792 | Tropical Forest Soil | GSHFGFHGQRVEKLADLKGALQAALAANKGGKTSILNVHVTR* |
| Ga0134067_102206112 | 3300010321 | Grasslands Soil | FGFHGRRVEKREELPGALKGALAATNDGRTAILNVMVSR* |
| Ga0134062_100891963 | 3300010337 | Grasslands Soil | GSHFGFHGERVEYRAELDLALQSALTATQEGRTAILNVVVSR* |
| Ga0126376_120998121 | 3300010359 | Tropical Forest Soil | GQRVENRAELEGALQSALAATQDGRTAILNVVVSR* |
| Ga0126372_106371321 | 3300010360 | Tropical Forest Soil | PDYERLGSHFGFHGQLVENRAELEGALQSALAASKGGRTAILNVMVSR* |
| Ga0126377_106274671 | 3300010362 | Tropical Forest Soil | KDLHYGVTIDGPDYEEFGSHFGFHGQRVENRAELEDALQSALAATKGGKTTILNVMVSR* |
| Ga0126377_135636222 | 3300010362 | Tropical Forest Soil | YPDGASASKDLHFGVTIDGPEYAELGSHFGFHGQRVEKLAELKGALAAALAATQAGKTSILNVMVTR* |
| Ga0105239_135100821 | 3300010375 | Corn Rhizosphere | GVTIDGPDYESLGSHFGFHGQRVENRAELATALTRALAATREGRTAILNAVVTR* |
| Ga0126381_1011152171 | 3300010376 | Tropical Forest Soil | DYEEFGSHFGFHGQRVENRAELEGALQSALAATKAGKTAILNVMVSR* |
| Ga0126381_1015166822 | 3300010376 | Tropical Forest Soil | ERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR* |
| Ga0126381_1022602451 | 3300010376 | Tropical Forest Soil | GQRVENRAELEGALQSALAASKGGRTAILNVMVSR* |
| Ga0126383_113078542 | 3300010398 | Tropical Forest Soil | VTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR* |
| Ga0126383_115635561 | 3300010398 | Tropical Forest Soil | IDGPDYEELGSHFGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR* |
| Ga0126383_124755562 | 3300010398 | Tropical Forest Soil | EEFGSHFGFHGQRVENRAELEGALQSALAATKGGKTAILNVMVSR* |
| Ga0124844_11469502 | 3300010868 | Tropical Forest Soil | HFGVTIDGPDYENLGSHFGFHGQRVENRAELATALTRALAATREGRTALLNAVVTR* |
| Ga0151489_17233651 | 3300011106 | Soil | PDYEQLGSHFGFHGARVETLAELKGAIQAALAATKAGKTAILNVHVSR* |
| Ga0153963_10601562 | 3300012070 | Attine Ant Fungus Gardens | FHGRRVENVAELDDAVRGALAAVKGGRTAILNVHVTR* |
| Ga0137399_110611251 | 3300012203 | Vadose Zone Soil | ERVEYHAELEIALRSALTATQEGRTAILNVVVSR* |
| Ga0137380_114238882 | 3300012206 | Vadose Zone Soil | RLGSHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ* |
| Ga0137381_106284952 | 3300012207 | Vadose Zone Soil | DYERLGSHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ* |
| Ga0137386_110130562 | 3300012351 | Vadose Zone Soil | SASKDLHYGVKIDGPDYERLGSHFGFDGQRVERLDELKAALQKALVAVQGGKTALLNVVLTR* |
| Ga0157286_103311852 | 3300012908 | Soil | EQLGSHFGFHGARVETLAELKGALQAGLAAIKAGKTAILNVHVNR* |
| Ga0164303_100893303 | 3300012957 | Soil | IDGPDYEQLGSHFGFHGARVETLAELKGAIQTALAATKAGKTAILNVHVSR* |
| Ga0164309_109600271 | 3300012984 | Soil | GARVETLAELKGAIQAALSATKAGKTAILNVHVSR* |
| Ga0164306_107941242 | 3300012988 | Soil | ASKELHFGVTIDGPDYESLGSHFGFHGQRVENRAELATALTRALAATREGRTALLNAVVTR* |
| Ga0134085_102611572 | 3300015359 | Grasslands Soil | TIDGPEYEKLGSHFGFHGERVEYRAELDLALQSALTATQEGRTAILNVVVSR* |
| Ga0182041_120082631 | 3300016294 | Soil | SHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ |
| Ga0182033_110850731 | 3300016319 | Soil | DGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0182032_109109592 | 3300016357 | Soil | YERLGSHFGFHGQRVENRAELEGALQSALAATKAGRTAILNVVVSR |
| Ga0182039_110120801 | 3300016422 | Soil | GERVEYRAELEVALSSALAATKEGKTAILNVVVSQ |
| Ga0183099_12582481 | 3300016744 | Bioreactor | EQLGSHFGFHGQRVESRAELESALQSALAATKGGKTAILNVLVSR |
| Ga0183099_12582482 | 3300016744 | Bioreactor | LGSHFGFHGQRVESRAELESALQSALAATKGGKTAILNVLVSR |
| Ga0190266_113538812 | 3300017965 | Soil | YEQLGSHFGFHGQRVEKLGELKGALQNALAAVKGGKTALLNVHLTR |
| Ga0187766_107518611 | 3300018058 | Tropical Peatland | GFHGKRLEKAAELKGALQCALAATIDGRTSILNAVLSE |
| Ga0184618_104772181 | 3300018071 | Groundwater Sediment | PDGASASKDLHYGVTIDGPDYEQLGSHFGFHGQRVEKLDELKSALQKALAAVQGGKTALLNVVLTR |
| Ga0184639_104819001 | 3300018082 | Groundwater Sediment | YGVTIDGPDYEQLGSHFGFHGARVETLAELKGALQAALAASKAGRTAIVNVHVNR |
| Ga0210407_101617633 | 3300020579 | Soil | HFGFHGARVEKLGALKGALKSALAATKDGKTSLLNVVLTR |
| Ga0193695_10453731 | 3300021418 | Soil | SHFGFHGARVEKLAALKGALKSALAATKDGKTSLLNVVLTR |
| Ga0126371_139405122 | 3300021560 | Tropical Forest Soil | HYPDGASASKDLHFGVTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0224452_10064621 | 3300022534 | Groundwater Sediment | YEQLGSHFGFHGARVETLAELKGALQTALAATKAGKTAILNVHVNR |
| Ga0247786_10636662 | 3300022883 | Soil | PEYEQLGSHFGFHGARVETLAELKDAIQAALAATKAGKTAILNVHVSR |
| Ga0207692_105904741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGSHFGFHGQRVEKLAELKGALASALAATKAGKTSILNVVVTR |
| Ga0207657_108112612 | 3300025919 | Corn Rhizosphere | DYEQLGSHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR |
| Ga0207690_101242641 | 3300025932 | Corn Rhizosphere | QLGSHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR |
| Ga0207665_100170301 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TIDGPDYEQLAGHFGFHGQRVEKSVELPGALRGALAATKDGRTAIVNACVTQ |
| Ga0210090_10257102 | 3300025965 | Natural And Restored Wetlands | HHYPDGASATSKVHYGVTIDGPAYEDLGKHFGFHGLRVEKPSELKAAIQAALDATKSGKTSILNVMLSK |
| Ga0209647_12145601 | 3300026319 | Grasslands Soil | DYEQLGSHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSH |
| Ga0257153_10442121 | 3300026490 | Soil | GSHFGFHGERVEYHAELEIALRSALTATQEGRTAILNVVVSR |
| Ga0209701_100816533 | 3300027862 | Vadose Zone Soil | FGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSH |
| Ga0307309_100321221 | 3300028714 | Soil | HFGFHGARVETLAELKGALQAALAATKAGRTAIVNVHVNR |
| Ga0307316_100598783 | 3300028755 | Soil | HFGFHGARVETLAELKGALQTALAATKAGKTAILNVHVNR |
| Ga0307288_104460571 | 3300028778 | Soil | HGARVEALAELKGALQAALAATKAGKTAILNVHVNR |
| Ga0307292_102418712 | 3300028811 | Soil | GASASKELHFGVTIDGPDYENLGSHFGFHGQRVENRAELATALTRALAATREGRTALLNAVVTR |
| Ga0307289_101572001 | 3300028875 | Soil | GARLETLAELKGAIQAALAATKAGKTAILNVHVSR |
| Ga0307495_100132051 | 3300031199 | Soil | GVTIDGPDYEQLGSHFGFHGARVETLAELKGALQAALAATKAGKTAIVNVHVNR |
| Ga0318528_104194532 | 3300031561 | Soil | LHFGVTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0318574_106741091 | 3300031680 | Soil | NLHYGVAIDGPNYEQLSSHFGFHGQRVEKVADLKGAIRKGLAATKEGKSSILNVVLTR |
| Ga0306917_115700842 | 3300031719 | Soil | GQRVENRAELEGALQSALAATKAGRTAILNVVVSR |
| Ga0307469_108751392 | 3300031720 | Hardwood Forest Soil | SHFGFHGARVETLAELKGAIQAALSATKAGKTAILNVHVSR |
| Ga0318500_103395151 | 3300031724 | Soil | HFGVTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0307468_1000240414 | 3300031740 | Hardwood Forest Soil | PDYAQLGSHFGFHGARVETLAELKGAIQAALAATKAGKTAILNVHVSR |
| Ga0318502_100913894 | 3300031747 | Soil | SSHFEFHGRRVERRAELPGALTDALAATKDGRSAILNVMVSR |
| Ga0318492_106714542 | 3300031748 | Soil | ASHFGFHGQRVETRAELEGALQSALAATKAGKTAILNVMVSR |
| Ga0318509_103958881 | 3300031768 | Soil | FEFHGRRVERRAELPGALTDALAATKDGRSAILNVMVSR |
| Ga0318566_104812511 | 3300031779 | Soil | SHFGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR |
| Ga0318508_12265391 | 3300031780 | Soil | ERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0318547_104550362 | 3300031781 | Soil | PDYEELGSHFGFHGQRVENRAELEGALQSALAATQDGRTAILNVVVSR |
| Ga0318547_109328932 | 3300031781 | Soil | FHGQRVEKVADLKGAIRKGLAATKEGKSSILNVVLTR |
| Ga0318552_103954211 | 3300031782 | Soil | GSHVGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR |
| Ga0318497_108676931 | 3300031805 | Soil | GSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0318567_104917852 | 3300031821 | Soil | TIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTAILNVMVSR |
| Ga0318517_100431153 | 3300031835 | Soil | HFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ |
| Ga0318544_103448362 | 3300031880 | Soil | KDLHFGVTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| Ga0306925_121845301 | 3300031890 | Soil | GVAIDGPNYEQLSSHFGFHGQRVEKVADLKGAIRKGLAATKEGKSSILNVVLTR |
| Ga0310916_102427932 | 3300031942 | Soil | DYEQLGSHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ |
| Ga0315904_109835002 | 3300031951 | Freshwater | TTRFHHGVEIDGPEYQDLGSHFGFFGAKTSTPAELKEALKDALAANAAGRTAILNVEMVR |
| Ga0318530_103327192 | 3300031959 | Soil | DYEEFANHFGFHGQRVETRAELEGALQSALAATKAGKTAILNVMVSR |
| Ga0318533_110122012 | 3300032059 | Soil | LGSHFGFHGERVEYRAELEVALSSALAATKEGKTAILNVVVSQ |
| Ga0318533_113197511 | 3300032059 | Soil | RNLHYGVAIDGPNYEQLSSHFGFHGQRVEKVADLKGAIRKGLAATKEGKSSILNVVLTR |
| Ga0318519_104569232 | 3300033290 | Soil | DLHFGVTIDGPDYERLGSHFGFHGQRVENRAELEGALQSALAASKGGRTSILNVMVSR |
| ⦗Top⦘ |