


| Basic Information | |
|---|---|
| Family ID | F092723 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MMYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFMD |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 38.32 % |
| % of genes near scaffold ends (potentially truncated) | 30.84 % |
| % of genes from short scaffolds (< 2000 bps) | 73.83 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.486 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (32.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.112 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 11.76% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF16805 | Trans_coact | 17.76 |
| PF02511 | Thy1 | 10.28 |
| PF08993 | T4_Gp59_N | 10.28 |
| PF14090 | HTH_39 | 6.54 |
| PF08804 | gp32 | 3.74 |
| PF05118 | Asp_Arg_Hydrox | 3.74 |
| PF08994 | T4_Gp59_C | 1.87 |
| PF03237 | Terminase_6N | 1.87 |
| PF00111 | Fer2 | 1.87 |
| PF00383 | dCMP_cyt_deam_1 | 1.87 |
| PF12705 | PDDEXK_1 | 1.87 |
| PF02562 | PhoH | 0.93 |
| PF00145 | DNA_methylase | 0.93 |
| PF01503 | PRA-PH | 0.93 |
| PF01818 | Translat_reg | 0.93 |
| PF00271 | Helicase_C | 0.93 |
| PF16510 | P22_portal | 0.93 |
| PF01370 | Epimerase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 10.28 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 3.74 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.93 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.93 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.49 % |
| All Organisms | root | All Organisms | 35.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 32.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.28% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.35% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 8.41% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.48% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.67% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.80% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.87% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.87% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.93% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.93% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.93% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.93% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.93% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.93% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001771 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Sites | Environmental | Open in IMG/M |
| 3300001781 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300004870 | Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012 | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006347 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_1000m | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021979 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS926 _150kmer | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025188 | Marine microbial communities from the Deep Atlantic Ocean - MP2913 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300026087 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300027622 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027709 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031603 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #185 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032138 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100839183 | 3300000101 | Marine | MYTLKVPNGTYKSDSLFVLFWTVIKHRIHHLIKDGKFDD* |
| DelMOSum2010_101520952 | 3300000101 | Marine | MTYELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKFMD* |
| BBAY94_100445725 | 3300000949 | Macroalgal Surface | MMYELKVPNGTYKADNLFRLFFVVLQHRLKHLIKDGKFMD* |
| JGI24006J15134_101070833 | 3300001450 | Marine | MTYELKVPNGTYMANNLFVLFFTVVKHRLHHLIKDGKFMD* |
| Beebe_10128532 | 3300001771 | Hydrothermal Vent Plume | MYELKVPNGTYKADNLFWLLIALFRHRFQHLIKNGKFMD* |
| Deep_10794442 | 3300001781 | Hydrothermal Vent Plume | MYHTVGRIHNIMYELKVPDGTYKADNLFWLLTAVFRHRFQHLI |
| M2t2BS2_102641552 | 3300002144 | Marine | MTYELKVPNGKYTADSLFVLFFIVVKHRLHHLIKDKKFMD* |
| KVWGV2_101871362 | 3300002242 | Marine Sediment | KTGATTDMTYELKVPNGTYKSDNLFWLLVAVFKHRLHHLIKDGKYMD* |
| FS896DNA_102515553 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MMYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFKD* |
| PicMicro_100180369 | 3300003702 | Marine, Hydrothermal Vent Plume | MYTLKVPNGIYKSDSLFVLFYTVLKHRFYHLVKDGKFHD* |
| Ga0071103_1494222 | 3300004870 | Marine | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKNGKFMD* |
| Ga0008649_100436924 | 3300005838 | Marine | MTYELKVKNGTYTADNLFALFFNVVRHRLHHLIKDKKFMD* |
| Ga0075108_100130635 | 3300005913 | Saline Lake | MKYELKVPNGTYTANNLFVLFFDVFTHRLYHLIKDRKFMD* |
| Ga0066369_102602861 | 3300005969 | Marine | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKDRKFMD* |
| Ga0066368_100405285 | 3300006002 | Marine | MYELKVPSGTYKADNLFWLLIAVFRHRFQHLIKNGKFMD* |
| Ga0066368_100792503 | 3300006002 | Marine | MMYELKVPNGTYKADNLFRLFFVVFQHRLKHLIKDGKFMD* |
| Ga0066368_100976003 | 3300006002 | Marine | MYELKVPNGKYTANNLFVLFFTIVKHRLYHLIKDKKFMD* |
| Ga0066368_101768453 | 3300006002 | Marine | LSTKTSTVTNMMYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFKD* |
| Ga0066382_103246822 | 3300006013 | Marine | MKYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFKD* |
| Ga0066375_101977431 | 3300006019 | Marine | MYLTVERTRNIMYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKNGKFMD* |
| Ga0075441_102030662 | 3300006164 | Marine | MYTLKVPNGTYKSDSLFILFWTVIRHRLYHLIKDGKFND* |
| Ga0066836_108626213 | 3300006166 | Marine | YTLKVPNGTYKSDSLIILMWTVFRHRLHHLIKDGKFDD* |
| Ga0075446_100720104 | 3300006190 | Marine | MKYKLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD* |
| Ga0075447_100325796 | 3300006191 | Marine | MTYELKVPNGTYTADNLFALFFNVVRHRLHHLIKDKKFMD* |
| Ga0068470_10945243 | 3300006308 | Marine | MIYELKVPNGTYKADNLFILFFVVFRHRLKHLIKDGKFMD* |
| Ga0068471_11820547 | 3300006310 | Marine | MTYFDINTGMSYELKVPNGTYKADNLFKLFFVVFRHRLKHLIKDGKFMD* |
| Ga0068471_13882034 | 3300006310 | Marine | MYELKVPNGTYKSHNLFWLLVAVFKHRLHHLVKDGKYMD* |
| Ga0068471_16263423 | 3300006310 | Marine | MYELKVPNGTYKANTLLRLLIAVFQHRLQHLIKDGKYMD* |
| Ga0068478_12269952 | 3300006311 | Marine | MIYELKVPNGTYKADNLFRLFFVVFQHRLYHLIKDGKFMD* |
| Ga0068481_13498832 | 3300006339 | Marine | MYELKVPNGTYKANTLLRLLIVVFHHRLRHLIKDGKYMD* |
| Ga0068503_101943342 | 3300006340 | Marine | MTYELKVPNGTYKSDNLFKLFFVVFQHRLYHLIKDGKFMD* |
| Ga0068503_102167191 | 3300006340 | Marine | KTSTITNMTYELKVPNGKYKSDSLFWLLVIVFRHRLYHLIKDGKFMD* |
| Ga0068503_103669373 | 3300006340 | Marine | MYELRVPNGTYKSDSLFRLFVTVLRHRLDHLIKDGKFMD* |
| Ga0068503_103695755 | 3300006340 | Marine | MMYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFMD* |
| Ga0099697_11635837 | 3300006347 | Marine | MMYELKVPNGTYKADNLFKLFFVVFQHRLYHLIKDGKFMD* |
| Ga0098044_10382701 | 3300006754 | Marine | MYTLKVPNGTYKSDSLIDLMWRVFRHRLHHLIKDGNFDD* |
| Ga0066376_100956112 | 3300006900 | Marine | MYELKVPDGTYKADNLFWLLITIFKHRFQHLIKDGKFMD* |
| Ga0098060_11161491 | 3300006921 | Marine | MYTLKVPNGTYKSDSLINLIWKVFRHRLHHLIKEGKFDD* |
| Ga0098036_11270373 | 3300006929 | Marine | MYTLKVPNGTYKSDSLIDLIWKVFRHRLHHLIKEGKFDD* |
| Ga0075444_100180542 | 3300006947 | Marine | MTYELKVPNGTYTANNLFALFFTVVKHRLHHLIKDGKFMD* |
| Ga0114898_10517452 | 3300008216 | Deep Ocean | MYELKVPSGTYKDDNLFWLLVSVFKHRFQHLIKDGRFID* |
| Ga0114905_10329774 | 3300008219 | Deep Ocean | MTYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFKD* |
| Ga0114995_102096402 | 3300009172 | Marine | MIYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD* |
| Ga0114995_103629433 | 3300009172 | Marine | NMTYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD* |
| Ga0114996_100687035 | 3300009173 | Marine | MKYQLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD* |
| Ga0114993_100488126 | 3300009409 | Marine | MIYELKVPNGKYTANNLFVLFFTVVKHRLHHLIKDRKFMD* |
| Ga0114994_101052964 | 3300009420 | Marine | MTYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD* |
| Ga0115003_105900712 | 3300009512 | Marine | MTYELKVPNGTYTANNLFALFFTVVKHRLHHLIKDRKFMD* |
| Ga0114906_10046845 | 3300009605 | Deep Ocean | MYTLKVPNGTYKADSLIHLLWAVFCHRFHHLITHGKFID* |
| Ga0114933_100240253 | 3300009703 | Deep Subsurface | MYELKVPNGTYKSDNLFWLLVAVFKHRLHHLIKDGKYMD* |
| Ga0114999_105019581 | 3300009786 | Marine | GSTPNMTYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD* |
| Ga0133547_101989752 | 3300010883 | Marine | MMYELKVPNGTYKADNLFRLFFVVFRHRLKHLIKDGKFKD* |
| Ga0133547_114521963 | 3300010883 | Marine | MYTLKVPNGTYKSDNLFVLFYIVLKHRLYHLAKDGKFQD* |
| Ga0114934_100227446 | 3300011013 | Deep Subsurface | MYTLKVPNGTYKSDSLFVLFWTVIRHRLHHLIKDGKFDD* |
| Ga0151669_1155343 | 3300011128 | Marine | MKHLKEVPNGTYTADNLFALFFNVVRHRLHHLIKDKKFMD* |
| Ga0181432_10852953 | 3300017775 | Seawater | MYELKVKNGTYKADNLFWLMWAVFYHRMEHLIQDGKFQD |
| Ga0181432_12144861 | 3300017775 | Seawater | RIELSTKTSTITNMMYELKVPNGTYKADNLFRLFFVVFQHRLKHLIKDGKFMD |
| Ga0211683_100237691 | 3300020372 | Marine | MTYELKVPNGTYTADNLFALFFNVVRHRLHHLIKDKKF |
| Ga0211682_100276135 | 3300020376 | Marine | MKYKLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD |
| Ga0211686_102848181 | 3300020382 | Marine | SRLKFSTSPSTTPRMKYKLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD |
| Ga0211697_100219691 | 3300020458 | Marine | MYELKVKNGVYKADSLFALVKAVLIHRFRHLINDGKWMD |
| Ga0211697_101015571 | 3300020458 | Marine | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKNGK |
| Ga0211697_101097344 | 3300020458 | Marine | ITNTMYELKVPNGTYKSENLFWLLVAIFKHRLHHLVKDGKFMD |
| Ga0211579_1000008650 | 3300020472 | Marine | MYELKVPNGTYKSDNLFWLFVAVFRHRFHHLIKDRKWMD |
| Ga0206679_102662841 | 3300021089 | Seawater | YTLKVPNGTYKSDSLFILFWTVIRHRLYHLIKDGKYDD |
| Ga0213869_100870435 | 3300021375 | Seawater | YELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKFMD |
| Ga0232641_13921492 | 3300021979 | Hydrothermal Vent Fluids | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKNGKFMD |
| Ga0209992_100292205 | 3300024344 | Deep Subsurface | MYTLKVPNGTYKSDSLFVLFWTVIRHRLHHLIKDGKFDD |
| Ga0244776_109293981 | 3300024348 | Estuarine | MIYELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKF |
| Ga0208919_10740835 | 3300025128 | Marine | MYTLKVPNGTYKSDSLIDLIWKVFRHRLHHLIKEGKFDD |
| Ga0209634_12724832 | 3300025138 | Marine | MIYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD |
| Ga0207913_10218161 | 3300025188 | Deep Ocean | IHNIMYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKDRKFMD |
| Ga0208179_10213795 | 3300025267 | Deep Ocean | LKVPDGTYKADNLFWLLIAVFRHRFQHLIKNGKFMD |
| Ga0208179_10691572 | 3300025267 | Deep Ocean | MYELKVPSGTYKDDNLFWLLVSVFKHRFQHLIKDGRFID |
| Ga0208449_10803182 | 3300025280 | Deep Ocean | MTYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKF |
| Ga0208030_11314731 | 3300025282 | Deep Ocean | YELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFKD |
| Ga0208134_11147842 | 3300025652 | Aqueous | MTYELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKFMD |
| Ga0208113_10288493 | 3300026087 | Marine | MMYELKVPNGTYKADNLFRLFFVVFQHRLKHLIKDGKFMD |
| Ga0209753_10424434 | 3300027622 | Marine | MYELKVPNGTYKADSLFLLFVAVFRHRFYHLVHDGKFQD |
| Ga0209710_10666725 | 3300027687 | Marine | MTYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD |
| Ga0209228_10369791 | 3300027709 | Marine | VYTLKVPNGTYKSDSLIILMWTVFRHRLHHLIKDGKFD |
| Ga0209709_100797455 | 3300027779 | Marine | MKYQLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD |
| Ga0209090_104550101 | 3300027813 | Marine | PSSTGTTPRMTYELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKFMD |
| Ga0209089_100090619 | 3300027838 | Marine | MIYELKVPNGKYTANNLFVLFFTVVKHRLHHLIKDRKFMD |
| Ga0209089_100185145 | 3300027838 | Marine | MMYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFMD |
| Ga0209089_105705761 | 3300027838 | Marine | MIYELKVPNGTYKADNLFILFFVVFRHRLKHLIKDGK |
| Ga0257110_11379853 | 3300028197 | Marine | TGTTSSMTYELKVPNGTYTANNLFVLFFTVVKHRLHHLIKDRKFMD |
| Ga0257109_10495483 | 3300028487 | Marine | MKYELKVPNGTYKADNLFRLFFVVFQHRLHHLIKDGKFVD |
| Ga0257112_100043199 | 3300028489 | Marine | MTYELKVPNGTYKSNSLFWLVVLVLRHRLMHLIKDRKFMD |
| Ga0308022_10555304 | 3300031142 | Marine | MTYELKVPNGTYTADNLFALFFNVVRHRLHHLIKDKKFMD |
| Ga0308010_11605663 | 3300031510 | Marine | SRLKFPTSPSTTPRMKYKLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD |
| Ga0302131_10181302 | 3300031594 | Marine | MTYELKVPNGTYTANNLFALFFTVVKHRLHHLIKDREFMD |
| Ga0308019_101788693 | 3300031598 | Marine | KFPTSPSTTPNMKYKLKVQNGTYTADNLFVLFFTVVKHRLHHLIKDKKFMD |
| Ga0307989_10299965 | 3300031603 | Marine | STPNMIYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD |
| Ga0302121_100263916 | 3300031626 | Marine | KVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD |
| Ga0308013_102483442 | 3300031721 | Marine | PSTTPRMTYELKVPNGTYTADNLFALFFNVVKHRLHHLIKDKKFMD |
| Ga0310122_101725791 | 3300031800 | Marine | MYELKVPNGTYKADNLFWLLIAVFRHRFQHLIKNRK |
| Ga0310122_103209662 | 3300031800 | Marine | RTHNIMYELKVPNGTYKADNLFWLLIAVFRHRFQHLIKNRKFMD |
| Ga0310121_100100262 | 3300031801 | Marine | MMYELKVPNGTYKADNLFRLFFVVFRHRLKHLIKDGKFKD |
| Ga0310121_100332046 | 3300031801 | Marine | MYTLKVPNGTYKSDNLFVLFYTVLKHRLYHLAKDGKFQD |
| Ga0310123_101167402 | 3300031802 | Marine | MKNIKYEYELKVPNGTYKADNLFWLLITVFGHRFHHLIKDRKFMD |
| Ga0310123_104370101 | 3300031802 | Marine | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKNRKFM |
| Ga0310123_106737092 | 3300031802 | Marine | MYELKVPDGTYKADNLFWLLIAVFRHRFQHLIKDGKFMD |
| Ga0315324_100517895 | 3300032019 | Seawater | KVPNGTYKSDSLFILFWTVIRHRLYHLIKDGKYDD |
| Ga0315338_10235434 | 3300032138 | Seawater | MIYELKVPNGTYKADNLFILFFVVFRHRLKHLIKDGKFMD |
| Ga0310345_101731853 | 3300032278 | Seawater | MYELKVPNGTYKANTLLRLLIAVFQHRLQHLIKDGKYMD |
| Ga0310345_111411461 | 3300032278 | Seawater | MMYELKVPNGTYKADNLFRLFFVVFQHRLKHLIKD |
| ⦗Top⦘ |