


| Basic Information | |
|---|---|
| Family ID | F092627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.206 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 2.80 |
| PF10011 | DUF2254 | 2.80 |
| PF13564 | DoxX_2 | 1.87 |
| PF00903 | Glyoxalase | 1.87 |
| PF08818 | DUF1801 | 1.87 |
| PF14023 | DUF4239 | 1.87 |
| PF13590 | DUF4136 | 1.87 |
| PF00072 | Response_reg | 0.93 |
| PF03976 | PPK2 | 0.93 |
| PF00107 | ADH_zinc_N | 0.93 |
| PF02424 | ApbE | 0.93 |
| PF00174 | Oxidored_molyb | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF00152 | tRNA-synt_2 | 0.93 |
| PF02371 | Transposase_20 | 0.93 |
| PF08308 | PEGA | 0.93 |
| PF06271 | RDD | 0.93 |
| PF00144 | Beta-lactamase | 0.93 |
| PF01758 | SBF | 0.93 |
| PF00672 | HAMP | 0.93 |
| PF01594 | AI-2E_transport | 0.93 |
| PF07589 | PEP-CTERM | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF04679 | DNA_ligase_A_C | 0.93 |
| PF00069 | Pkinase | 0.93 |
| PF05345 | He_PIG | 0.93 |
| PF13505 | OMP_b-brl | 0.93 |
| PF13442 | Cytochrome_CBB3 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.74 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.87 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.87 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.87 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.93 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.93 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.93 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.93 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.93 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.93 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.93 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.93 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.21 % |
| Unclassified | root | N/A | 45.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig109930 | Not Available | 530 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101590182 | Not Available | 508 | Open in IMG/M |
| 3300002914|JGI25617J43924_10307517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300004635|Ga0062388_100257542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
| 3300005332|Ga0066388_104723773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300005435|Ga0070714_100066991 | Not Available | 3095 | Open in IMG/M |
| 3300005544|Ga0070686_100104070 | Not Available | 1922 | Open in IMG/M |
| 3300005545|Ga0070695_100701164 | Not Available | 803 | Open in IMG/M |
| 3300005602|Ga0070762_10461807 | Not Available | 827 | Open in IMG/M |
| 3300005764|Ga0066903_103884721 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 802 | Open in IMG/M |
| 3300006173|Ga0070716_100146714 | Not Available | 1512 | Open in IMG/M |
| 3300007788|Ga0099795_10574641 | Not Available | 534 | Open in IMG/M |
| 3300010043|Ga0126380_11923302 | Not Available | 539 | Open in IMG/M |
| 3300010046|Ga0126384_10241231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300010048|Ga0126373_10796654 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010048|Ga0126373_12535985 | Not Available | 571 | Open in IMG/M |
| 3300010048|Ga0126373_13001434 | Not Available | 526 | Open in IMG/M |
| 3300010358|Ga0126370_11609357 | Not Available | 622 | Open in IMG/M |
| 3300010359|Ga0126376_12364916 | Not Available | 578 | Open in IMG/M |
| 3300010360|Ga0126372_11971139 | Not Available | 630 | Open in IMG/M |
| 3300010376|Ga0126381_101030856 | Not Available | 1188 | Open in IMG/M |
| 3300010376|Ga0126381_101314079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300010376|Ga0126381_102380269 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010400|Ga0134122_10645097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300010868|Ga0124844_1198448 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010868|Ga0124844_1309670 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012202|Ga0137363_10393645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1153 | Open in IMG/M |
| 3300012202|Ga0137363_10830052 | Not Available | 784 | Open in IMG/M |
| 3300012203|Ga0137399_10716077 | Not Available | 842 | Open in IMG/M |
| 3300012918|Ga0137396_10924339 | Not Available | 638 | Open in IMG/M |
| 3300012922|Ga0137394_11523985 | Not Available | 527 | Open in IMG/M |
| 3300012925|Ga0137419_11620397 | Not Available | 551 | Open in IMG/M |
| 3300012948|Ga0126375_10529624 | Not Available | 885 | Open in IMG/M |
| 3300014165|Ga0181523_10007570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8382 | Open in IMG/M |
| 3300014200|Ga0181526_10339276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300015374|Ga0132255_104470278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300016270|Ga0182036_10772405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 781 | Open in IMG/M |
| 3300016270|Ga0182036_11631694 | Not Available | 543 | Open in IMG/M |
| 3300016294|Ga0182041_11716770 | Not Available | 581 | Open in IMG/M |
| 3300016319|Ga0182033_11754848 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300016319|Ga0182033_11929035 | Not Available | 537 | Open in IMG/M |
| 3300016341|Ga0182035_11125126 | Not Available | 699 | Open in IMG/M |
| 3300016341|Ga0182035_11593268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 589 | Open in IMG/M |
| 3300016357|Ga0182032_11946988 | Not Available | 515 | Open in IMG/M |
| 3300016422|Ga0182039_11133417 | Not Available | 705 | Open in IMG/M |
| 3300016422|Ga0182039_11958766 | Not Available | 538 | Open in IMG/M |
| 3300016702|Ga0181511_1314387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300016750|Ga0181505_10453633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300017934|Ga0187803_10250016 | Not Available | 702 | Open in IMG/M |
| 3300017937|Ga0187809_10130861 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300017974|Ga0187777_10322340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300017999|Ga0187767_10154531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300020199|Ga0179592_10242473 | Not Available | 810 | Open in IMG/M |
| 3300020581|Ga0210399_10261617 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300020581|Ga0210399_10298592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1344 | Open in IMG/M |
| 3300021180|Ga0210396_11161263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300021181|Ga0210388_10952609 | Not Available | 738 | Open in IMG/M |
| 3300021401|Ga0210393_10058240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3041 | Open in IMG/M |
| 3300021402|Ga0210385_10749026 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300021405|Ga0210387_11073250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300021405|Ga0210387_11468938 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300021406|Ga0210386_10336357 | Not Available | 1297 | Open in IMG/M |
| 3300021420|Ga0210394_10300069 | Not Available | 1409 | Open in IMG/M |
| 3300021478|Ga0210402_10963154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300021560|Ga0126371_13932435 | Not Available | 500 | Open in IMG/M |
| 3300026490|Ga0257153_1102752 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026909|Ga0207858_1021251 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027825|Ga0209039_10151174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300027829|Ga0209773_10111975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300028072|Ga0247675_1041914 | Not Available | 675 | Open in IMG/M |
| 3300028379|Ga0268266_10691209 | Not Available | 983 | Open in IMG/M |
| 3300028906|Ga0308309_10281559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1401 | Open in IMG/M |
| 3300031128|Ga0170823_11692248 | Not Available | 734 | Open in IMG/M |
| 3300031231|Ga0170824_112826295 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300031474|Ga0170818_110911985 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300031474|Ga0170818_112962533 | Not Available | 556 | Open in IMG/M |
| 3300031744|Ga0306918_10297892 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300031744|Ga0306918_10976323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 658 | Open in IMG/M |
| 3300031744|Ga0306918_11100458 | Not Available | 615 | Open in IMG/M |
| 3300031823|Ga0307478_10183633 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300031823|Ga0307478_10376850 | Not Available | 1172 | Open in IMG/M |
| 3300031833|Ga0310917_10884923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031879|Ga0306919_11392411 | Not Available | 529 | Open in IMG/M |
| 3300031910|Ga0306923_11395177 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031910|Ga0306923_11569837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300031910|Ga0306923_11596435 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 678 | Open in IMG/M |
| 3300031912|Ga0306921_10009600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10271 | Open in IMG/M |
| 3300031912|Ga0306921_11258089 | Not Available | 821 | Open in IMG/M |
| 3300031912|Ga0306921_12067424 | Not Available | 604 | Open in IMG/M |
| 3300031941|Ga0310912_10091135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2229 | Open in IMG/M |
| 3300031941|Ga0310912_10902165 | Not Available | 680 | Open in IMG/M |
| 3300031942|Ga0310916_11282099 | Not Available | 603 | Open in IMG/M |
| 3300031946|Ga0310910_11015423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300031954|Ga0306926_10078808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4003 | Open in IMG/M |
| 3300031954|Ga0306926_10395319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1706 | Open in IMG/M |
| 3300032160|Ga0311301_11981700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300032180|Ga0307471_103114451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300032261|Ga0306920_102846432 | Not Available | 657 | Open in IMG/M |
| 3300032783|Ga0335079_10405176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
| 3300032892|Ga0335081_11685048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 692 | Open in IMG/M |
| 3300032893|Ga0335069_10121254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3275 | Open in IMG/M |
| 3300032897|Ga0335071_10707120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300032897|Ga0335071_11803350 | Not Available | 556 | Open in IMG/M |
| 3300033134|Ga0335073_10408765 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300033289|Ga0310914_10130203 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300033289|Ga0310914_11703925 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0929.00006440 | 2166559005 | Simulated | TDPDKIWKTADSNIKSAFKRYPPSPKDIEAKKQQWAKEDAAKKSSQP |
| INPhiseqgaiiFebDRAFT_1015901822 | 3300000364 | Soil | DPDKIWKTADRNIKKAFRSYPPTAKAIQEKKAEWAKVDAAKKSAQP* |
| JGI25617J43924_103075172 | 3300002914 | Grasslands Soil | IWKTADSNIKKAFRSYPPTAKAIEEKKAEWAKIDAAKKSAQP* |
| Ga0062388_1002575421 | 3300004635 | Bog Forest Soil | PDKIWKSVDSSIKKAFKAYRPSPEAIAAKKQQWAKEDAATNMK* |
| Ga0066388_1047237731 | 3300005332 | Tropical Forest Soil | NDPNKIWKTADSDIINVFKSYPPKAKAIEEKKAGCAKIDAAKEPAQP* |
| Ga0070714_1000669911 | 3300005435 | Agricultural Soil | DPDKIWKTADSNIVKAFKLYPPTVKAIEEKKAERAKIDAAQKPPQR* |
| Ga0070686_1001040703 | 3300005544 | Switchgrass Rhizosphere | TDPDKIWKTADSNIKNAFKRYPPSPKEIEEKKQQWAKEDAAKKPCQPQQ* |
| Ga0070695_1007011642 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | QTDPDKIWKTADSNIKNAFKRYPPSSKDIEAKKQQWAKEDASKKSSQP* |
| Ga0070762_104618072 | 3300005602 | Soil | HTDPEKIWKTADSNIKNAFKRYPPSPKEIEEKKQQWVEEDAAKKPSQPQ* |
| Ga0066903_1038847213 | 3300005764 | Tropical Forest Soil | HNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMGATKKSAQP* |
| Ga0070716_1001467142 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LIHSDSAKIWKTADSNIKNAFKSYPPSPKAVEAKKQQWAKEDAAKKSSQP* |
| Ga0099795_105746411 | 3300007788 | Vadose Zone Soil | SNIKNAFKRYPPSPKDIEAKKQQWAKEDADKKSSQP* |
| Ga0126380_119233022 | 3300010043 | Tropical Forest Soil | SERIIHNDPDKVWNTADKNILKAFKSYPPTAKAIDEKKAQWAKIDAAKKSAQP* |
| Ga0126384_102412311 | 3300010046 | Tropical Forest Soil | IHNDPDKIWKTADKNIIKAFKSYPPTAKAIEEKKAEWAKMGATKKSAQP* |
| Ga0126373_107966542 | 3300010048 | Tropical Forest Soil | EKIIHNDPDKIWKTADKNILKAFKSYPPTAKAIEEKKAEWAKIDAGKNSAQH* |
| Ga0126373_125359851 | 3300010048 | Tropical Forest Soil | ADNNIRNAFKSYPPSAKDIEAKKQQWSKEDADKNSSSAPR* |
| Ga0126373_130014342 | 3300010048 | Tropical Forest Soil | VSEKIIHNDPDKIWKTADKNIIKAFKSFPPTAKAIEEKKAEWAKMDAAKKPAHP* |
| Ga0126370_116093571 | 3300010358 | Tropical Forest Soil | ADSNIIKAFKSYPPTAKAIQEKKAEWAKIDAAKKPAQP* |
| Ga0126376_123649161 | 3300010359 | Tropical Forest Soil | DPDKIWKTADSNIKNAFKSYPPTAKAIEAKKAERARTDAAK* |
| Ga0126372_119711392 | 3300010360 | Tropical Forest Soil | KIWKTADSNIRNAFKSYPPSAKDIEAKKQQWSKEDADNKSSSAPR* |
| Ga0126381_1010308562 | 3300010376 | Tropical Forest Soil | PDKIWKTADNNIRNAFKSYPPSAKDIEAKKQQWSKEDADKKSSSAPR* |
| Ga0126381_1013140791 | 3300010376 | Tropical Forest Soil | DKIWKSVDSSIKKGFKAYQPSPEAIGAKKQQWAKEDAEKKPA* |
| Ga0126381_1023802691 | 3300010376 | Tropical Forest Soil | IWKIADSNIIKGFKSYPPTAKAIKEKKAEWAKIDAAKKPAQP* |
| Ga0126383_136236531 | 3300010398 | Tropical Forest Soil | WRLFVSEKIIHSDPDKIWKTADSGIKKGFKSYPPSPKAIEEKKAEWAKTDPGKMPAQPN* |
| Ga0134122_106450971 | 3300010400 | Terrestrial Soil | TDPDKIWKAAASNIKNAFKRYPPSPNDIEVKKQQRAREDASKKSSQPQ* |
| Ga0124844_11984482 | 3300010868 | Tropical Forest Soil | PDKIWNTADKNILKAFKSYPPTAKAIDEKKAQWAKIDATKKSSQP* |
| Ga0124844_13096701 | 3300010868 | Tropical Forest Soil | RQNLEHCRYKNILKAFKSYPPTAKAIDEKKAQWAKIDATKKSSQP* |
| Ga0137363_103936452 | 3300012202 | Vadose Zone Soil | NIKNAFSRYPPSPKDIDAKKQQWAKEDAAKESSQPQ* |
| Ga0137363_108300521 | 3300012202 | Vadose Zone Soil | NSNPDKIWKTADSNIKNAFGRYPPSPKDIDAKKQQWAKEDAARKSSQPQ* |
| Ga0137399_107160771 | 3300012203 | Vadose Zone Soil | TNSNPDKIWKTADSNIKNAFGRYPPSPKDIDAKKQQWAKEDTAKKSSEPQ* |
| Ga0137396_109243391 | 3300012918 | Vadose Zone Soil | NPDKIWKTADSNIKNAFGRYPPSPKDIDAKKQQWAKEDAAKESSQH* |
| Ga0137394_115239852 | 3300012922 | Vadose Zone Soil | KNAFKRFPPSPKDIEEKKQQWAKEDAAKKPSQPQ* |
| Ga0137419_116203971 | 3300012925 | Vadose Zone Soil | KIWKTADSNIKNAFSRYPPSPKDIDAKKQQWAKEDAAKESSQRY* |
| Ga0126375_105296242 | 3300012948 | Tropical Forest Soil | EKIIHNDPDKIWKTAESNIIKAFKSYPPTAKAIEEKKAERAKIDAARKPSQP* |
| Ga0181523_100075701 | 3300014165 | Bog | KIWKTADKNIIKAFKNYPPTAQAIKEKKAEWDKKEAAKKSAQP* |
| Ga0181526_103392762 | 3300014200 | Bog | WKTADKNIIKAFKNYPPTAQAIKEKKAEWDKKEAAKKSAQP* |
| Ga0132255_1044702781 | 3300015374 | Arabidopsis Rhizosphere | DKIWKTADDNIVKAFKRYPPTAKAIEEKKAERVKMDAKKSAQP* |
| Ga0182036_107724052 | 3300016270 | Soil | IIHNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0182036_116316941 | 3300016270 | Soil | IIHNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0182041_117167701 | 3300016294 | Soil | DPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0182033_117548482 | 3300016319 | Soil | NDPDKIWKTADSNIIKAFKSYPPTAKAIEEKKAEWAKIDAAKKPAQP |
| Ga0182033_119290351 | 3300016319 | Soil | IHNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0182035_111251262 | 3300016341 | Soil | WKTADSNIIKAFKSYPPTAKSIEEKKAEWAKIDAAKKPGQP |
| Ga0182035_115932681 | 3300016341 | Soil | DKIWKTADKNIIKAFKSYPPTPKAIEEKKAERAKIDAAKKPAQP |
| Ga0182032_119469881 | 3300016357 | Soil | KTADSNIKKAFKSYPPAAKAIEEKKAEWAKMGATKKSAQP |
| Ga0182039_111334171 | 3300016422 | Soil | IWKTADKNILKAFKSYPPTAKAIEEKKAEWAKIDAGKNSAQH |
| Ga0182039_119587662 | 3300016422 | Soil | PDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0181511_13143872 | 3300016702 | Peatland | DKNIIKAFKNYPPTAQAIKEKKEEWAKKEAAKKSAQP |
| Ga0181505_104536332 | 3300016750 | Peatland | WKTADKNIIKAFKNYPPTAQAIKEKKAEWDKKEAAKKSAQP |
| Ga0187803_102500161 | 3300017934 | Freshwater Sediment | PDKIWKTAEKNIIQAFKNYPPTAEAIEEKKAEWAKIEAAKKSAQP |
| Ga0187809_101308611 | 3300017937 | Freshwater Sediment | NIIKAFKNYPPTAEAIEEKKAEWAKIEAAKKSAQP |
| Ga0187777_103223401 | 3300017974 | Tropical Peatland | NIKKAFRSYPPTAKAIEEKKAEWARIDASKKSAQP |
| Ga0187767_101545313 | 3300017999 | Tropical Peatland | IHNDPDKIWKTADRNIKNAFKSYPPTAKAIEEKKAQWAKMDATKNASQP |
| Ga0179592_102424732 | 3300020199 | Vadose Zone Soil | DKIWKTADSNIKNAFGRYPPSPKDIDAKKQQWAKEDAAKKSSEPQ |
| Ga0210399_102616172 | 3300020581 | Soil | DSNIKSAFKRYPPSPKDIDAKKKQWAKEDTLKTQSQP |
| Ga0210399_102985923 | 3300020581 | Soil | WRLFVSEKIIHNDPDKIWKTADSNIIKAFKNYPPTAGAIEEKKAAWAKAEAAKKSAQP |
| Ga0210396_111612631 | 3300021180 | Soil | TADTNIIKAFKNYPPTPGAIEKKKAERAKIDAAKKSAQP |
| Ga0210388_109526092 | 3300021181 | Soil | DKIWKTADSNIVKAFKRYPPTAEAIEEKKAERAKIDAAKKPPQR |
| Ga0210393_100582401 | 3300021401 | Soil | SAKIWKTADSNIKDAFKSYPPSPKAVEAKKQQWAKEDAAKKPS |
| Ga0210385_107490262 | 3300021402 | Soil | KIWKTADANIIKAYKSYPPTADAIEKKKAEWAKIDATKKPAQP |
| Ga0210387_110732502 | 3300021405 | Soil | NDPDKIWKTADSNIIKAFKNYPPTAIAIEEKKAAWAKAEAAKKSGQP |
| Ga0210387_114689383 | 3300021405 | Soil | PDKIWKTADSNIIKAFKSYPPTAKAIEEKKAEWAKIDAAKKSARP |
| Ga0210386_103363573 | 3300021406 | Soil | IWKTADSNIKDAFKNYPPSPKAIEEKKEQWAKEDSAKNSPQP |
| Ga0210394_103000693 | 3300021420 | Soil | IWKTADSNIVKAFKLYPPTAKAIEEKKAERAKIDAAKKPPQR |
| Ga0210402_109631541 | 3300021478 | Soil | QKIWKIADGNIKNGFKRFPPSPKDIEAKEQQWAKEDAAKKPSQP |
| Ga0126371_139324351 | 3300021560 | Tropical Forest Soil | DSNIKKAFKSYPPAAKAIEEKKAEWAKMHATKKSAQP |
| Ga0257153_11027521 | 3300026490 | Soil | TDPDKIWKTADSNIKNAFKRFPPSAKDIAEKKQQWAKEDAAKKPAEPQ |
| Ga0207858_10212511 | 3300026909 | Tropical Forest Soil | WKTADKNIIKAFKSYPPTAKDIEEKKAERAKADAAKKSAQP |
| Ga0209039_101511742 | 3300027825 | Bog Forest Soil | ADNNIKDAFKRFPPSAKDIAAKKQQWAKEDATKKSGKP |
| Ga0209773_101119751 | 3300027829 | Bog Forest Soil | DKIWKSVDSSIKKAFKAYRPSPEAIAAKKQQWAKEDAATNMK |
| Ga0247675_10419141 | 3300028072 | Soil | NIIKAFKNYPPTARAIAEKKAAWARTEAAKKSAQP |
| Ga0268266_106912091 | 3300028379 | Switchgrass Rhizosphere | WKTADSNIKNAFKRYPPSSKDIEAKKQQWAKEDASKKSSQP |
| Ga0308309_102815591 | 3300028906 | Soil | DKIWKTADSNIVKAFKLYPPTAKAIEEKKAERAKIDAAKKPPQR |
| Ga0170823_116922481 | 3300031128 | Forest Soil | ADSNIKNAFKRYPPSPKEIEEKKQQWAKEDAAKKPSQPQ |
| Ga0170824_1128262953 | 3300031231 | Forest Soil | HTDPDKIWKTADSNIKNAFKRFPPSPKDIEEKKQQWAKEDAAKKPSQPQ |
| Ga0170818_1109119851 | 3300031474 | Forest Soil | KIWKTADSNIKNAFKSYPPSPKAVEAKKHQWAKEDAAKKPS |
| Ga0170818_1129625331 | 3300031474 | Forest Soil | IHSDSAKIWKTADSNIKNAFKSYPPSPKDIEAKKQQWAKEDAAKKPSQP |
| Ga0306918_102978924 | 3300031744 | Soil | IHNDPDKIWKTADKNILKAFKSYPPTAKAIEEKKAERVKIDAGKNSAQH |
| Ga0306918_109763231 | 3300031744 | Soil | NIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0306918_111004582 | 3300031744 | Soil | TADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0307478_101836333 | 3300031823 | Hardwood Forest Soil | TEPDKIWKTADSNIKNAFKRYPPSPKEIEEKKQQWAKDDAAKKPSQPQ |
| Ga0307478_103768502 | 3300031823 | Hardwood Forest Soil | LFVSEKIIHNDPDKIWKTAEKNIIKAFKNYPPTAEAIEEKKAEWAKIEAAKKPGQP |
| Ga0310917_108849231 | 3300031833 | Soil | DKIWKTADSNIKNAFKRYPPSPKDIEVKKQQWAKEDAAEKSSQHQ |
| Ga0306919_113924112 | 3300031879 | Soil | TADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0306923_113951771 | 3300031910 | Soil | NIKKAFKSYPPTAKAIEEKKLEWAKIDATKKSAQP |
| Ga0306923_115698371 | 3300031910 | Soil | NDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0306923_115964352 | 3300031910 | Soil | HNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0306921_1000960014 | 3300031912 | Soil | KIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0306921_112580892 | 3300031912 | Soil | VSEKIIHNDPDKIWKTADSNIIKAFKSYPPTAKSIEEKKAEWAKIDAAKKPGQP |
| Ga0306921_120674242 | 3300031912 | Soil | TADSNIKKAFKSYPPAAKAIEEKKAEWAKMGATKKSAQP |
| Ga0310912_100911351 | 3300031941 | Soil | DKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0310912_109021653 | 3300031941 | Soil | VDSSIKKGFKAYQPSPEAIAAKKQQWAKEDAAANMK |
| Ga0310916_112820991 | 3300031942 | Soil | DKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMGATKKSAQP |
| Ga0310910_110154231 | 3300031946 | Soil | IQTDPDKIWKTADSNIKNAFKRYPPSPKDIEVKKQQWAKEDAAEKSSQHQ |
| Ga0306926_100788087 | 3300031954 | Soil | KIIHNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKIDATKKSVQP |
| Ga0306926_103953191 | 3300031954 | Soil | KIIHNDPDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMDATKKSAQP |
| Ga0311301_119817001 | 3300032160 | Peatlands Soil | DPDKIWKTADSNIKKAFRSYPPTAKAIEEKKAEWAKIDAAKKSAQP |
| Ga0307471_1031144512 | 3300032180 | Hardwood Forest Soil | ADSNIKNAFKSYPPSPKAVEAKKQQWAKEDAAKKSSQP |
| Ga0306920_1028464322 | 3300032261 | Soil | PDKIWKTADSNIKKAFKSYPPAAKAIEEKKAEWAKMGATKKSAQP |
| Ga0335079_104051761 | 3300032783 | Soil | EKSIVKAFKFYPPTQRAMEEKKAEWAKAEAAKKPAQP |
| Ga0335081_116850481 | 3300032892 | Soil | ADSNIIKAFKNFPPTAKAIEEKKAEWAKIDAAKKPAQP |
| Ga0335069_101212541 | 3300032893 | Soil | NIKNAFKSYPPTAKAIEEKKAQWAKMGATKNSAQP |
| Ga0335071_107071201 | 3300032897 | Soil | PNKIWKTADSNITKAFKSYPPTPKAIEEKKAEWAKIDAAQGPAKP |
| Ga0335071_118033502 | 3300032897 | Soil | DPNKIWKTADDNIKKGFKSYPPMARAIEEKKAEWAKMDAAKQPVQP |
| Ga0335073_104087653 | 3300033134 | Soil | WKTADSNITKAFKSYPPTPKAIEEKKAEWAKIDAAQGPAKP |
| Ga0310914_101302032 | 3300033289 | Soil | VSEKIIHNDPDKIWKTADSDIIKAFKSYPPTAKAIEEKKAEWAKIDAAKKPE |
| Ga0310914_117039251 | 3300033289 | Soil | IIHSDPDKIWKTADKNIVKAFNSYPPTAKAVEEKKAERAKIDATKKPAQP |
| ⦗Top⦘ |