


| Basic Information | |
|---|---|
| Family ID | F092625 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ENLVFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 96.26 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.972 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 0.00% Coil/Unstructured: 85.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07676 | PD40 | 73.83 |
| PF01149 | Fapy_DNA_glyco | 11.21 |
| PF06831 | H2TH | 6.54 |
| PF14685 | Tricorn_PDZ | 1.87 |
| PF13701 | DDE_Tnp_1_4 | 0.93 |
| PF00171 | Aldedh | 0.93 |
| PF14684 | Tricorn_C1 | 0.93 |
| PF00326 | Peptidase_S9 | 0.93 |
| PF02230 | Abhydrolase_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 17.76 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.93 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.93 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001137|JGI12637J13337_1021401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300003223|JGI26343J46809_1021453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300004092|Ga0062389_100793200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300005176|Ga0066679_10201099 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300005330|Ga0070690_100513569 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005332|Ga0066388_104319425 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005353|Ga0070669_101867869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300005467|Ga0070706_101629215 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005533|Ga0070734_10795948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005566|Ga0066693_10160495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005569|Ga0066705_10645914 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005602|Ga0070762_10950824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005610|Ga0070763_10526579 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005617|Ga0068859_100243150 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300005618|Ga0068864_102099231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300006041|Ga0075023_100475125 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006173|Ga0070716_100170484 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300006176|Ga0070765_100652926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300006354|Ga0075021_11141053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300006893|Ga0073928_10901530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300007265|Ga0099794_10132598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300009177|Ga0105248_11481029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300009553|Ga0105249_11710338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300010046|Ga0126384_11329167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300010047|Ga0126382_10411811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
| 3300010159|Ga0099796_10391018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010343|Ga0074044_10577407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300010358|Ga0126370_11371970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300010359|Ga0126376_10070271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2559 | Open in IMG/M |
| 3300010360|Ga0126372_11489885 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010362|Ga0126377_10206667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1886 | Open in IMG/M |
| 3300010376|Ga0126381_103270736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300010398|Ga0126383_10034929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4038 | Open in IMG/M |
| 3300010398|Ga0126383_10674778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300010937|Ga0137776_1849782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300011270|Ga0137391_10861201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300011270|Ga0137391_11039520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012096|Ga0137389_11164449 | Not Available | 660 | Open in IMG/M |
| 3300012189|Ga0137388_10399523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300012200|Ga0137382_10199312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300012200|Ga0137382_10252509 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012202|Ga0137363_10932955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012207|Ga0137381_10792226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300012350|Ga0137372_10760603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300012362|Ga0137361_10558824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012362|Ga0137361_11510861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012582|Ga0137358_10345053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300012685|Ga0137397_10476386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300012925|Ga0137419_11108414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300012927|Ga0137416_10290944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300012929|Ga0137404_10571690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300012931|Ga0153915_12701220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012944|Ga0137410_11343016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300015077|Ga0173483_10999774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300016294|Ga0182041_10785250 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300016294|Ga0182041_11318454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300016387|Ga0182040_11918161 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017930|Ga0187825_10309763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300018468|Ga0066662_12023356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300020579|Ga0210407_10893554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300020580|Ga0210403_11241995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300021086|Ga0179596_10305323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300021168|Ga0210406_10773247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300021170|Ga0210400_10029852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4229 | Open in IMG/M |
| 3300021171|Ga0210405_10816936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300021171|Ga0210405_11074411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300021178|Ga0210408_10306588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300021178|Ga0210408_10680582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300021402|Ga0210385_10931914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021406|Ga0210386_11494545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300022522|Ga0242659_1017038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300022557|Ga0212123_10729330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300024219|Ga0247665_1032512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300024330|Ga0137417_1107017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1389 | Open in IMG/M |
| 3300025906|Ga0207699_10587052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300025923|Ga0207681_11804466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300025939|Ga0207665_10208289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300025941|Ga0207711_11113736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300026095|Ga0207676_11891354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027562|Ga0209735_1148916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027846|Ga0209180_10728702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027853|Ga0209274_10077826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1611 | Open in IMG/M |
| 3300027879|Ga0209169_10390954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300028789|Ga0302232_10510020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300028906|Ga0308309_10248190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1488 | Open in IMG/M |
| 3300028906|Ga0308309_11594004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300029636|Ga0222749_10408014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300031240|Ga0265320_10062929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300031708|Ga0310686_113588908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300031744|Ga0306918_10788055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300031820|Ga0307473_10716290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300031823|Ga0307478_10051069 | Not Available | 3067 | Open in IMG/M |
| 3300031823|Ga0307478_11531881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031823|Ga0307478_11816441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031912|Ga0306921_12244636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300031947|Ga0310909_11038420 | Not Available | 668 | Open in IMG/M |
| 3300031959|Ga0318530_10080243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300032076|Ga0306924_10422774 | Not Available | 1524 | Open in IMG/M |
| 3300032174|Ga0307470_10517316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300032180|Ga0307471_104170475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032205|Ga0307472_100325586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300032261|Ga0306920_100430869 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300032261|Ga0306920_100752627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300032828|Ga0335080_12193044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032898|Ga0335072_11303854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300032955|Ga0335076_10643083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300034124|Ga0370483_0033915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12637J13337_10214011 | 3300001137 | Forest Soil | DNLVFVLIGNASAIGPAIKKYADKIDQRPISDPGFWPPPAGAQK* |
| JGI26343J46809_10214532 | 3300003223 | Bog Forest Soil | VFVLIGNASSVGPAVKKYAEKIDQRPISDPGFWPPSAGAQK* |
| Ga0062389_1007932001 | 3300004092 | Bog Forest Soil | FVLIGKASAIGPAVKKYADKMDERPIGDPGFWPPPAGSQK* |
| Ga0066679_102010992 | 3300005176 | Soil | IQKRFPSENLVFVLIGKASAIAPAVEKYAEKRDSRAISEPGFWPPEKKN* |
| Ga0070690_1005135691 | 3300005330 | Switchgrass Rhizosphere | PAENLVFLLIGKASEIRPAVEKYATQQDTRKISEPGFWPAPGK* |
| Ga0066388_1043194252 | 3300005332 | Tropical Forest Soil | KQVIAKHFPADNLVFLLIGKAAEIRPVVLKYATQQDMRKISDPGFWPAPAR* |
| Ga0070669_1018678691 | 3300005353 | Switchgrass Rhizosphere | AENLVFLLIGKASEIRPAVEKYATQQDTRKISEPGFWPAPGK* |
| Ga0070706_1016292152 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEKHFPEENLVFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK* |
| Ga0070734_107959481 | 3300005533 | Surface Soil | AIGPAVKKYAPTQDARAISDPGFWPAPAAATTKK* |
| Ga0066693_101604952 | 3300005566 | Soil | LVFVLIGKAAAIGPAVEKYAEKRDARAIAEPGFWPGTK* |
| Ga0066705_106459141 | 3300005569 | Soil | KHFPEDNLVFLLIGKASEIGSAVEKYATQRDMRKISEPGFWPGAK* |
| Ga0070762_109508241 | 3300005602 | Soil | QKHFPSDNLVFTLIGKRSEIAAGVQKYTAKQDARVIREPGFWPPPAQK* |
| Ga0070763_105265791 | 3300005610 | Soil | PAENLVFVLIGKASAIGPAVKKYATTQDTRPIGDPGFWPAPVAASKK* |
| Ga0068859_1002431501 | 3300005617 | Switchgrass Rhizosphere | KHFPADNLVFMLIGKAAEIRPAVEKYATQQDTRKISEPGFWPASGK* |
| Ga0068864_1020992312 | 3300005618 | Switchgrass Rhizosphere | DNLVFMLIGKAAEIRPAVEKYATQQDTRKISEPGFWPASGK* |
| Ga0075023_1004751252 | 3300006041 | Watersheds | PEIARQVIQKHFPKENLVFVVIGKASTIGPVVQKYAGKEDSRAISEPGFWPPPDTKVSRE |
| Ga0070716_1001704842 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FPQENLVFVLIGKASEIGPAVEKYATQRDSRKISDPGFWPGAK* |
| Ga0070765_1006529261 | 3300006176 | Soil | ENLVFVLIGKASAIGPAVQKYASNQDTRLISDPGFWPAPAGTGN* |
| Ga0075021_111410532 | 3300006354 | Watersheds | LLIGNAGAIAPAVKQYATTQDARKISEPGFWPPPVK* |
| Ga0073928_109015302 | 3300006893 | Iron-Sulfur Acid Spring | FVLIGKSSAIEKAVEKYAEKRDARPIAEPGFWPPPSK* |
| Ga0099794_101325982 | 3300007265 | Vadose Zone Soil | HFPSENLVFVLIGKASAIAPAVEKYAEKRDSRAISEPGFWPPEKKN* |
| Ga0105248_114810291 | 3300009177 | Switchgrass Rhizosphere | TKQVIEKHFPADNLVFLLIGKATEIRPAIEKYATQQDTRKISDPGFWPAPGK* |
| Ga0105249_117103382 | 3300009553 | Switchgrass Rhizosphere | VIEKHFPAENLVFLLIGKASEIRPAVEKYATQQDTRKISEPGFWPAPGK* |
| Ga0126384_113291672 | 3300010046 | Tropical Forest Soil | HFPKENMVFVLIGKAAEIAPAVKKYADAQDARKISDPGFWPPAK* |
| Ga0126382_104118111 | 3300010047 | Tropical Forest Soil | ATKETIAKHFPADNLVFLLIGKASEIRPAVAKYAAQQDTRKISDPGFWPAPRK* |
| Ga0099796_103910182 | 3300010159 | Vadose Zone Soil | ENLVFVLIGKASAIGAAVEKYAEKRDAREIAAPGFWPPEKP* |
| Ga0074044_105774072 | 3300010343 | Bog Forest Soil | GKAAAIGPAVEKYAEMRDTRAIEDPGFWPPPEARQ* |
| Ga0126370_113719702 | 3300010358 | Tropical Forest Soil | FPSADLVFLLIGKASEIRPAVAKYAAQQDTRKISDSGFWPPPGK* |
| Ga0126376_100702712 | 3300010359 | Tropical Forest Soil | LIGKASEIAPTVKKYADTQDTRKISDPGFWPPAK* |
| Ga0126372_114898852 | 3300010360 | Tropical Forest Soil | VFVLIGKASEIAPAVKKYADTQDARKISEPGFWPPAK* |
| Ga0126377_102066672 | 3300010362 | Tropical Forest Soil | VFLLIGKASEIGPAVGKYASERDTRKISEPGFWPPAGR* |
| Ga0126381_1032707362 | 3300010376 | Tropical Forest Soil | VFLLIGKASEIRPALAKYATQQDMRKISEPGFWPAPGK* |
| Ga0126383_100349293 | 3300010398 | Tropical Forest Soil | LIGKASEIRPALAKYATQQDMRKISEPGFWPAPGK* |
| Ga0126383_106747781 | 3300010398 | Tropical Forest Soil | ENMVFVLIGKASEIGPAVKKYAEKQDERKISEPGFWPPAK* |
| Ga0137776_18497822 | 3300010937 | Sediment | LVFVLIGKASEIGPAVKKYADKQDDRKINEPGFWPPPAK* |
| Ga0137391_108612011 | 3300011270 | Vadose Zone Soil | IGKASAIEKAVEKYAEKRDARPIAEPGFWPPPSK* |
| Ga0137391_110395201 | 3300011270 | Vadose Zone Soil | HYPEDNLVFMLIGKASQIGPAVQKYATQQDTRKISEPGFWPGTK* |
| Ga0137389_111644491 | 3300012096 | Vadose Zone Soil | EDNLVFMLIGKASQIGPAVQKYATQQDTRKISEPGFWPGTK* |
| Ga0137388_103995231 | 3300012189 | Vadose Zone Soil | RQAIQKHFPAENLVFVLIGKSSAIEKGVAKYAEKRDARPIAEPGFWPPPSK* |
| Ga0137382_101993121 | 3300012200 | Vadose Zone Soil | KHFPSENLVFVLIGKASAIGTAVEKYAEKRDAREIAAPGFWPPEKP* |
| Ga0137382_102525091 | 3300012200 | Vadose Zone Soil | DLVFVLIGKASAVTHAVQKYAEKQDARAVAEPGFWPPPTGKE* |
| Ga0137363_109329552 | 3300012202 | Vadose Zone Soil | VFVLIGKASAIGKAVEKYAEKRDARAISEPGFWPPPSAVIK* |
| Ga0137381_107922261 | 3300012207 | Vadose Zone Soil | KHFPEENLIFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK* |
| Ga0137372_107606031 | 3300012350 | Vadose Zone Soil | IARQVIEKHFPEENLIFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK* |
| Ga0137361_105588242 | 3300012362 | Vadose Zone Soil | PAIARQVIEKHFPEENLVFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK* |
| Ga0137361_115108611 | 3300012362 | Vadose Zone Soil | ENLVFVLIGKASAIGKAVEKYAEKRDARAISEPGFWPPQGAAIK* |
| Ga0137358_103450531 | 3300012582 | Vadose Zone Soil | NLAFVLIGNSSAIEKAIEKYADKRDARPITDPGFWPPPGK* |
| Ga0137397_104763862 | 3300012685 | Vadose Zone Soil | ENLVFMLIGKASEIGPAVQKYAPQQDSRKISEPGFWPPPGK* |
| Ga0137419_111084141 | 3300012925 | Vadose Zone Soil | AMAKQVIEKHFPEDNLVFLLIGKASEIGPAVKKYAAQQDSRKISEPGFWPGAK* |
| Ga0137416_102909442 | 3300012927 | Vadose Zone Soil | FVLIGKASEIGPSVKKYADKQDARKISDAGFWPPKEEVKK* |
| Ga0137404_105716901 | 3300012929 | Vadose Zone Soil | PEENLVFMLIGKASEIGPAVQKYASQQDSRKISEPGFWPPPSK* |
| Ga0153915_127012201 | 3300012931 | Freshwater Wetlands | SLVFVLIGKASAIGPAVKKYADKMDERPISDPGFWPPQTGAQK* |
| Ga0137410_113430162 | 3300012944 | Vadose Zone Soil | AKQVIAKHFPEENLAFMLIGKASEIGPGVKKYAAQQDSRKISEPGFWPGAK* |
| Ga0173483_109997741 | 3300015077 | Soil | VTLPAAKQAIEKHFPAENLVFLLIGKASAIRPTVEKYAPQQDTRKISEPGFWPAPGK* |
| Ga0182041_107852501 | 3300016294 | Soil | KHFPRENLVFAMIGKASEIGPAMKKYAEKRDEREISAPGYWPGSK |
| Ga0182041_113184542 | 3300016294 | Soil | VAKQVIEKHFPEENLAFMLIGKASEIRPAIEKYAPQQDTRKIVDPGFWPPPGK |
| Ga0182040_119181613 | 3300016387 | Soil | PEENLVFVLIGKASAIGSAVTKYSEKQDTRPVSEPGFWPQK |
| Ga0187825_103097631 | 3300017930 | Freshwater Sediment | FPKENLVFVLIGKSSAIGPAVQKYAEKQDARAIGEPGFWPPPGARISSK |
| Ga0066662_120233562 | 3300018468 | Grasslands Soil | LVFVLIGKASAIGAAVEKYAEKRDAREIAAPGFWPPEKP |
| Ga0210407_108935541 | 3300020579 | Soil | NLVFVLIGKSSAIGKAVEKYAEKRDARAISEPGFWPPPSEVTK |
| Ga0210403_112419951 | 3300020580 | Soil | IQKHFPLENVVFVVIGNASAIGPAIEKYAGKRDARAIGDPGFWPPPAAQK |
| Ga0179596_103053231 | 3300021086 | Vadose Zone Soil | PAENLVFVLIGKASAIGTAVEKYAEKRDAREIAAPGFWPPEKQ |
| Ga0210406_107732472 | 3300021168 | Soil | FVVIGKAAAIAPALKKYAEKQNTREIAEPGFWMAEQSKK |
| Ga0210400_100298521 | 3300021170 | Soil | VLIGKASAIRAAVEKYAEKRDARAISEPGFWPPETK |
| Ga0210405_108169362 | 3300021171 | Soil | NLVFVLIGNASAIGPAVKKYADKMDQRPISDPGFWPPPVGAQK |
| Ga0210405_110744112 | 3300021171 | Soil | ENLVFVVIGKASTIGPVVQKYAGKEDSRAINEPGFWPPPDTNVSRK |
| Ga0210408_103065881 | 3300021178 | Soil | VFALIGNASAIGPAVKKYAEKQDARKIAEPGFWPAGK |
| Ga0210408_106805821 | 3300021178 | Soil | LIGKASAIEPAIKKYAEKIDQRRISDPGFWPPPAGSQK |
| Ga0210385_109319142 | 3300021402 | Soil | LIGDASAIRLAVKKYADKMDERPVSDPGFWPPPGAQK |
| Ga0210386_114945452 | 3300021406 | Soil | LVFVLIGKASAIGPAVQKYATSQDTRLISDPGFWPAPAAGKK |
| Ga0242659_10170381 | 3300022522 | Soil | HFPVDNLVFVLIGDASAIRLAVKKYADKMDERPVSDPGFLPPPGAQK |
| Ga0212123_107293301 | 3300022557 | Iron-Sulfur Acid Spring | FVLIGKSSAIEKAVEKYAEKRDARPIAEPGFWPPPSK |
| Ga0247665_10325122 | 3300024219 | Soil | DNLVFMLIGKAAEIRSAVEKYATQLDTRKISDPGFWPAPVK |
| Ga0137417_11070171 | 3300024330 | Vadose Zone Soil | ASAIGVLIGKASAIGAAMEKYAEKRDARAISEPGFWPPPSAVIK |
| Ga0207699_105870522 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVLIGKAAEIRPAVKKYAETMDERKISEPGFWPPAK |
| Ga0207681_118044662 | 3300025923 | Switchgrass Rhizosphere | FLLIGKASEIRPAVEKYATQQDTRKISEPGFWPAPGK |
| Ga0207665_102082892 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FPQENLVFVLIGKASEIGPAVEKYATQRDSRKISDPGFWPGAK |
| Ga0207711_111137361 | 3300025941 | Switchgrass Rhizosphere | TLPVTKQVIEKHFPADNLVFLLIGKATEIRPAIEKYATQQDTRKISDPGFWPAPGK |
| Ga0207676_118913542 | 3300026095 | Switchgrass Rhizosphere | DNLVFMLIGKAAEIRPAVEKYATQQDTRKISEPGFWPASGK |
| Ga0209735_11489161 | 3300027562 | Forest Soil | GNASAIGPAIKKYADKIDQRPISDPGFWPPPAGAQK |
| Ga0209180_107287021 | 3300027846 | Vadose Zone Soil | RQAIQKHFPAENLVFVLIGKSSAIEKGVAKYAEKRDARPIAEPGFWPPPSK |
| Ga0209274_100778262 | 3300027853 | Soil | LIGQASAIGPAVKKYADKMDQRPISEPGFWPPPGAQK |
| Ga0209169_103909542 | 3300027879 | Soil | AFMLIGEASAIRPAVRKYADKMDERPISDPGFWPPPSGAQK |
| Ga0302232_105100202 | 3300028789 | Palsa | EENLVFVLIGKSAAIAAAVKKYGEKQDAREISAAGFWPGT |
| Ga0308309_102481902 | 3300028906 | Soil | DLVFVLIGKASEIGPAVKKYAAKEDTRSITAPGYWPGSK |
| Ga0308309_115940042 | 3300028906 | Soil | FPLDNFVVVLIGNASAIRPAIKKYADKMDQRRISDPGFWPAPAGAEK |
| Ga0222749_104080141 | 3300029636 | Soil | NLVFVLIGKASAVGPAVKKYADKVDGRSITEPGFWPPPAAPK |
| Ga0265320_100629292 | 3300031240 | Rhizosphere | FVLIGKASAIGPAVKKYADKIDQRPISDLGFWPPPAGAQK |
| Ga0310686_1135889081 | 3300031708 | Soil | NLVFVLIGNASAIGPAVKKYADKIDQRPISDPGFWPPPASAQK |
| Ga0306918_107880552 | 3300031744 | Soil | FMLIGKASEIHPAVEKYAAQRDARKIADPGFWPPPAK |
| Ga0307473_107162901 | 3300031820 | Hardwood Forest Soil | PRENLVFVVIGRAAEIAPAVRKYADKEDTRKIEDAGFWPAPK |
| Ga0307478_100510691 | 3300031823 | Hardwood Forest Soil | QMIQKHFPEENLVFVVIGKAAAIAPALKKYAEKQNTREIAEPGFWTAEQSKK |
| Ga0307478_115318811 | 3300031823 | Hardwood Forest Soil | FPAENLVFVLIGKSSAIGKAVEKYAEKRDARAISEPGFWPPPSGVTK |
| Ga0307478_118164412 | 3300031823 | Hardwood Forest Soil | PEIAKQVIAKHYPEDNLVFMLIGKASEIGPAVQKYAAQQDMRKISEAGFWPGAAGSK |
| Ga0306921_122446361 | 3300031912 | Soil | QVIAKHFPEDNLVFMLIGKASEIHPAVEKYAAQRDARKIADPGFWPPPAK |
| Ga0310909_110384201 | 3300031947 | Soil | VFVLIGKASAIGSAVTKYSEKQDTRPVSEPGFWPQK |
| Ga0318530_100802431 | 3300031959 | Soil | PVTRQVIERHFPADSLVFLLIGKASEIRPALAKYATQQDMRKISEPGFWPAPGK |
| Ga0306924_104227741 | 3300032076 | Soil | CPEENLVFVLIGKASAMGSAVTKYSEKQDTRPVSEPGFWPQK |
| Ga0307470_105173162 | 3300032174 | Hardwood Forest Soil | SENLVFVLIGKASTIGPAVEKYAEKRDARPISEPGFWPPSTGMTK |
| Ga0307471_1041704751 | 3300032180 | Hardwood Forest Soil | ENLVFMLIGKASEIGPEVRKYATQQDSRKISEPGFWPGAK |
| Ga0307472_1003255862 | 3300032205 | Hardwood Forest Soil | KHFPEENLVFMLIGKASEIGPVVQKYATQHDTRKITEPGFWPPPAK |
| Ga0306920_1004308693 | 3300032261 | Soil | IEKHFPEESLVFMLIGKGSEIRSAVGKYATQQDTRKISEPGFWPPPAK |
| Ga0306920_1007526271 | 3300032261 | Soil | KHFPRDNLVFMLIGKASEIEPVVRKYATQHDTRKITEPGFWPPPAK |
| Ga0335080_121930441 | 3300032828 | Soil | QIIEKHFPRENLVFLLIGKASEIGPAVKKYAEKQDERKISEPGFWPPPAK |
| Ga0335072_113038541 | 3300032898 | Soil | SGTLVFTLIGKASEIAPQVKKYATHMDTRQISDPGFWPPPAK |
| Ga0335076_106430832 | 3300032955 | Soil | NLVFVLIGKASEIRPAVKKYAGQMDERSINDPGFWPPPSASASK |
| Ga0370483_0033915_1444_1560 | 3300034124 | Untreated Peat Soil | NLVFVLIGKSAAIAPAVKKYADKQDAREISAPGFWPGS |
| ⦗Top⦘ |