


| Basic Information | |
|---|---|
| Family ID | F092578 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.34 % |
| % of genes near scaffold ends (potentially truncated) | 68.22 % |
| % of genes from short scaffolds (< 2000 bps) | 94.39 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.785 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF05870 | PA_decarbox | 14.95 |
| PF13372 | Alginate_exp | 12.15 |
| PF00158 | Sigma54_activat | 9.35 |
| PF00171 | Aldedh | 8.41 |
| PF02954 | HTH_8 | 6.54 |
| PF00857 | Isochorismatase | 5.61 |
| PF01408 | GFO_IDH_MocA | 5.61 |
| PF08447 | PAS_3 | 4.67 |
| PF00561 | Abhydrolase_1 | 1.87 |
| PF08240 | ADH_N | 0.93 |
| PF01527 | HTH_Tnp_1 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF00484 | Pro_CA | 0.93 |
| PF00512 | HisKA | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3479 | Phenolic acid decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 14.95 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 8.41 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 8.41 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 8.41 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 5.61 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.61 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001142|JGI12702J13316_10019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2368 | Open in IMG/M |
| 3300001867|JGI12627J18819_10309580 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101811502 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004152|Ga0062386_101564151 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005541|Ga0070733_10455842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300005555|Ga0066692_10328835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300005555|Ga0066692_10856678 | Not Available | 557 | Open in IMG/M |
| 3300005568|Ga0066703_10584299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300005602|Ga0070762_10755572 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005712|Ga0070764_10417854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300005718|Ga0068866_10839935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300005921|Ga0070766_11095446 | Not Available | 550 | Open in IMG/M |
| 3300006028|Ga0070717_11486889 | Not Available | 615 | Open in IMG/M |
| 3300006173|Ga0070716_101009129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia udeis | 658 | Open in IMG/M |
| 3300006176|Ga0070765_101053812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 768 | Open in IMG/M |
| 3300006797|Ga0066659_11753239 | Not Available | 524 | Open in IMG/M |
| 3300006847|Ga0075431_100889287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300007076|Ga0075435_100867817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300007265|Ga0099794_10338961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300007788|Ga0099795_10191645 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300009038|Ga0099829_10175833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1721 | Open in IMG/M |
| 3300009089|Ga0099828_10780119 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300011270|Ga0137391_10366298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 1236 | Open in IMG/M |
| 3300011271|Ga0137393_10266207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1456 | Open in IMG/M |
| 3300012189|Ga0137388_10596031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300012202|Ga0137363_10544050 | Not Available | 978 | Open in IMG/M |
| 3300012202|Ga0137363_11134345 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012205|Ga0137362_11024392 | Not Available | 703 | Open in IMG/M |
| 3300012361|Ga0137360_11226681 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012924|Ga0137413_10183973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1392 | Open in IMG/M |
| 3300012925|Ga0137419_11062492 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012927|Ga0137416_10626651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300015054|Ga0137420_1437368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1943 | Open in IMG/M |
| 3300018433|Ga0066667_10064587 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300018468|Ga0066662_12594252 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300019887|Ga0193729_1066041 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300019890|Ga0193728_1191336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300020062|Ga0193724_1057200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300020580|Ga0210403_10739847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300020580|Ga0210403_11337728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300020581|Ga0210399_10589925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300020581|Ga0210399_10680812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300020582|Ga0210395_10381863 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300020583|Ga0210401_10127171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2389 | Open in IMG/M |
| 3300020583|Ga0210401_10962823 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300020583|Ga0210401_11569671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300021168|Ga0210406_11271434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300021170|Ga0210400_10051523 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300021170|Ga0210400_10294576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1331 | Open in IMG/M |
| 3300021170|Ga0210400_10358864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1200 | Open in IMG/M |
| 3300021170|Ga0210400_11362864 | Not Available | 566 | Open in IMG/M |
| 3300021178|Ga0210408_10160346 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300021344|Ga0193719_10156777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300021404|Ga0210389_10535251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300021405|Ga0210387_11266341 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021420|Ga0210394_11268298 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021432|Ga0210384_11702946 | Not Available | 536 | Open in IMG/M |
| 3300021433|Ga0210391_10866560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300021474|Ga0210390_10227100 | Not Available | 1580 | Open in IMG/M |
| 3300021478|Ga0210402_10892228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300021478|Ga0210402_11478990 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021478|Ga0210402_11665657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300021478|Ga0210402_11791386 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021559|Ga0210409_11035073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300024330|Ga0137417_1128635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1151 | Open in IMG/M |
| 3300024330|Ga0137417_1417481 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025905|Ga0207685_10345000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300026356|Ga0257150_1030016 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026374|Ga0257146_1021746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300026374|Ga0257146_1045773 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300026482|Ga0257172_1107200 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026489|Ga0257160_1007528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1469 | Open in IMG/M |
| 3300026499|Ga0257181_1059588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300026998|Ga0208369_1021104 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027034|Ga0209730_1036642 | Not Available | 563 | Open in IMG/M |
| 3300027073|Ga0208366_1002989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300027174|Ga0207948_1003596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
| 3300027603|Ga0209331_1158627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300027869|Ga0209579_10245640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300027875|Ga0209283_10921144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300027884|Ga0209275_10280724 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300027889|Ga0209380_10166314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
| 3300027907|Ga0207428_10564353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 822 | Open in IMG/M |
| 3300028020|Ga0265351_1005892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300028023|Ga0265357_1036503 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300030991|Ga0073994_10002768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031708|Ga0310686_107958806 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031715|Ga0307476_11188789 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031718|Ga0307474_10078153 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300031718|Ga0307474_10796614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031718|Ga0307474_10829112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031720|Ga0307469_10561045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300031754|Ga0307475_10169741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1738 | Open in IMG/M |
| 3300031820|Ga0307473_10296002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300031820|Ga0307473_10578444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300031962|Ga0307479_10295085 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300031962|Ga0307479_10576377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300031962|Ga0307479_10705656 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031962|Ga0307479_11527029 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031962|Ga0307479_11696090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031962|Ga0307479_12102424 | Not Available | 512 | Open in IMG/M |
| 3300032174|Ga0307470_10040937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2294 | Open in IMG/M |
| 3300032180|Ga0307471_102398929 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032180|Ga0307471_103477105 | Not Available | 557 | Open in IMG/M |
| 3300032180|Ga0307471_103810349 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032205|Ga0307472_100420557 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300032205|Ga0307472_100856949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia udeis | 836 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 18.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001142 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12702J13316_100191 | 3300001142 | Forest Soil | LKRRKKKGGELPVDLVKLVKIAISPVLGKGLAEFEVAFTNP |
| JGI12627J18819_103095802 | 3300001867 | Forest Soil | LKGQKKKGGKLPVDLVKLAKIAISPVLGKGLAEFE |
| JGIcombinedJ26739_1018115021 | 3300002245 | Forest Soil | LKXQXKXXGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNP* |
| Ga0062386_1015641511 | 3300004152 | Bog Forest Soil | MRTIRKRLKIQKKYDGNLLVDLGKLAKIAISPVLGKGLAEFEVAFTNP* |
| Ga0070733_104558423 | 3300005541 | Surface Soil | LKRQKKKSGKLSVDLVKLVKIAISPIPGKDLAEFEAA |
| Ga0066692_103288351 | 3300005555 | Soil | LKRQKKKRGKLAVDLVKLAKIAISPVLGKGLAEFEVAFT |
| Ga0066692_108566782 | 3300005555 | Soil | LKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNP* |
| Ga0066703_105842991 | 3300005568 | Soil | KGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTNP* |
| Ga0070762_107555721 | 3300005602 | Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFPF |
| Ga0070764_104178542 | 3300005712 | Soil | RKRLKRQKKKGGKLLVDLVKLAKIAISPVFGKGLAEFEVAFANP* |
| Ga0068866_108399351 | 3300005718 | Miscanthus Rhizosphere | LPVDLVKLAKIAISPVLGKGLAESEVAFMNPVARLL* |
| Ga0070766_110954461 | 3300005921 | Soil | KGGKLPVDLVKLAKIAISPVLGKVLAEFEVAFTNP* |
| Ga0070717_114868891 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PKRLKGQKKKGGKLLADLVKLAKIAISPVLGKGLAEFEVAFTNPVADLL* |
| Ga0070716_1010091292 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRQKKKGGKLLVDLVKLVEIAISPVLKKKGLAAFEEAFTNPVAHLL* |
| Ga0070765_1010538123 | 3300006176 | Soil | RQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEAAPTNP* |
| Ga0066659_117532391 | 3300006797 | Soil | RLKRQKKKGGKLLVDLVKLVEIAISPVLRKGLAEFEEAFTNPVAHLL* |
| Ga0075431_1008892871 | 3300006847 | Populus Rhizosphere | RTIRKRLKIQKKKSGKLAVDLVKLAKIAISPVLGKGLAEFEVAFTNP* |
| Ga0075435_1008678172 | 3300007076 | Populus Rhizosphere | RTEEKKGKLPVNLVKLAKIAISPVMGKGLAEFEVAFTNP* |
| Ga0099794_103389612 | 3300007265 | Vadose Zone Soil | LPVDLVKLAKIAISPVLGNGLAEFEVAFTNPVAHLL* |
| Ga0099795_101916451 | 3300007788 | Vadose Zone Soil | LKRQKKYDGKLLVDLGKLAKIAISPVLRKSLADFEVVFTNP |
| Ga0099829_101758331 | 3300009038 | Vadose Zone Soil | RLKRQKRRGGKRLVDLVRMAKIAISPALGKGLVEFEVAFTNPVAHLL* |
| Ga0099828_107801191 | 3300009089 | Vadose Zone Soil | LKRQKKKGGKLTVDLVKLAKIAISPILGKGLAEFEVAFTNP* |
| Ga0137391_103662981 | 3300011270 | Vadose Zone Soil | KRLKGQKKKRGKVLGELVKLAKIAISPVLRKGLAEFEVAFANP* |
| Ga0137393_102662071 | 3300011271 | Vadose Zone Soil | LKRQKKKGGKLAVDLVKLAKIAISPVLGNGLAEFEVAFTNPVAH |
| Ga0137388_105960312 | 3300012189 | Vadose Zone Soil | LKGQKKKGPKVLVNFVKLAKIAISPVLGNGVAEFEEAFTNPVAHLL* |
| Ga0137363_105440502 | 3300012202 | Vadose Zone Soil | MRTIRMRLKRQKKKGAKLPVFLVKLAKIAISPVLAKGLAEFEVALTNP* |
| Ga0137363_111343452 | 3300012202 | Vadose Zone Soil | LKRQKKKGGKLLVDLVELAKIAISAVLGKGLAEFEVAFANP* |
| Ga0137362_110243922 | 3300012205 | Vadose Zone Soil | MRTIRMRLKRQKKKGAKLPVLLVKLAKIAISPVLAKGLAEFEVALTNP* |
| Ga0137360_112266811 | 3300012361 | Vadose Zone Soil | LKRQKKKGGKPPVDLVKLAKIAISPVLGNGLAEFEVAFTNPVAHR |
| Ga0137413_101839733 | 3300012924 | Vadose Zone Soil | LKRQKKKGGKLAVDLVKLAKLAISPVLGNGLAEFEVAFTNPVAH |
| Ga0137419_110624922 | 3300012925 | Vadose Zone Soil | MRLKRQKKKGAKLPVFLVKLAKIAISPVLAKGLAEFEVALTNP* |
| Ga0137416_106266512 | 3300012927 | Vadose Zone Soil | GKLPVDLVKLAKIAISPVLGNGLAEFEVAFTNPVARLL* |
| Ga0137420_14373681 | 3300015054 | Vadose Zone Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTNSGVH |
| Ga0066667_100645871 | 3300018433 | Grasslands Soil | LKRQKKKGGKLLVDLVKLVEIAISPVLRKGLAEFEEAFTNPVAHLL |
| Ga0066662_125942522 | 3300018468 | Grasslands Soil | LKRQKKKRGKLAVDLVKLAKIAISPVLGKGLAEFEVAFTN |
| Ga0193729_10660411 | 3300019887 | Soil | KRLKKQKKKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTNP |
| Ga0193728_11913361 | 3300019890 | Soil | KGQKKKGGKLPVNLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Ga0193724_10572001 | 3300020062 | Soil | KGGKLLVDLVKLAKTAISPVLGKGLAEFEVAFANS |
| Ga0210403_107398472 | 3300020580 | Soil | IRKRLKRQKKKGGKLLVDLVRLAKIAISPVLGKGLAEFEAAFANP |
| Ga0210403_113377281 | 3300020580 | Soil | LKRQKKKSGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Ga0210399_105899251 | 3300020581 | Soil | QKKKKKSGKLSMDLVKLAKIAISPALGKGLLAEFEVALTNP |
| Ga0210399_106808121 | 3300020581 | Soil | KKGGKLPVDLVKLAKIAISPVLAKGLDEFEVAFTNP |
| Ga0210395_103818632 | 3300020582 | Soil | KGQKKKGPKVLVNFVKLAKIAISPVPRKGLAEFEVAFTNP |
| Ga0210401_101271711 | 3300020583 | Soil | RLKRQKKKEGKLLVDLVKLAKLAISPVLGKGLAEFEVAFANP |
| Ga0210401_109628232 | 3300020583 | Soil | LKRQKKKGGKLLVDLVKLVEIAISPILRKGLAEFEEAFTNPAAHL |
| Ga0210401_115696711 | 3300020583 | Soil | KKGGKLPVDLVKLAKIAISPALGKGLAEFEVAFTNP |
| Ga0210406_112714341 | 3300021168 | Soil | KKGGKLLVDLVKLAKIAISPVFGKGLAEFELAFANS |
| Ga0210400_100515233 | 3300021170 | Soil | LKRQKKKGGKLPVDLVKLAEIAISPVLGKALAEFEVAFTKP |
| Ga0210400_102945763 | 3300021170 | Soil | LKRQKNRGEKLPLDVVKLAKIAISPVLAKGLAEFEVAF |
| Ga0210400_103588641 | 3300021170 | Soil | LKRQKKKGGKLLVDLVKLVEIAISPVLRKKGLAEFEVAFTNPVAHLL |
| Ga0210400_113628642 | 3300021170 | Soil | IRKRLKGHKKKGGKLLVNFVKLAKVAISPVMGKGLAEYEVAFANP |
| Ga0210408_101603463 | 3300021178 | Soil | CKRRTIPKRLKRQKKKEGKLLVDLVKLAKLAISPVLGKGLAEFEVAFANP |
| Ga0193719_101567771 | 3300021344 | Soil | RLKRQKKKGGKLPVDLVKLAEIAISPVLGKGLAEFEVAFANP |
| Ga0210389_105352511 | 3300021404 | Soil | RPIRKRLKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Ga0210387_112663412 | 3300021405 | Soil | LKKQKKKGGKLLVDLVKLAKIAISPVFGKGLAEFEVAFANP |
| Ga0210394_112682981 | 3300021420 | Soil | LKREKKKGGKLPVNLVKLAKIAISPVLGSGLAEFEVAFPFC |
| Ga0210384_117029461 | 3300021432 | Soil | LKRQKKRGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTNPVAHLL |
| Ga0210391_108665601 | 3300021433 | Soil | IRKRLKRQKKKGGKLLVDLVKLAKIAIPPVLGKGLAEFEVAFTNP |
| Ga0210390_102271002 | 3300021474 | Soil | MPKRLKGQKKKGGKLLADLVKLAKIAISPVLGKGPTEFEVAFTNP |
| Ga0210402_108922281 | 3300021478 | Soil | RLKRQKKTGGKLLVDLVKLAKIAIPPVLGKGLAEFEVAFTNP |
| Ga0210402_114789902 | 3300021478 | Soil | LKRQKNRGEKLPLDVVKLAKIAISPVLRKDLAEFEVAFTNPQ |
| Ga0210402_116656571 | 3300021478 | Soil | RRTIRKRLKRQKKKGGKLLVDLVKLAEIAISPVFGKGLAEFEVAFTNP |
| Ga0210402_117913862 | 3300021478 | Soil | MPKRLKGQKKKGGKLLADLVKLAKIAISPVLGKGPAEFEVAFTNP |
| Ga0210409_110350731 | 3300021559 | Soil | LKKQKKKGGKLLVDLVKLAKTAISPVLGKGLAEFEVAFANS |
| Ga0137417_11286353 | 3300024330 | Vadose Zone Soil | LKRQKKKGGKLLVDLVKLVEIAISPVLRKDLAEFEVAFTI |
| Ga0137417_14174812 | 3300024330 | Vadose Zone Soil | LKRQKKKGGKLTVDLVKLAKIAVSPILGKGLAEFEVAFTNP |
| Ga0207685_103450001 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KKKGGKLPVDLVKLAKIAISPVLAKGLAEFEVAFTNP |
| Ga0257150_10300162 | 3300026356 | Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGNSLAEFEVAFTNPVAHR |
| Ga0257146_10217461 | 3300026374 | Soil | RKRLKKQKKKGGKLLGDLVKLAKTAISPVLGKGLAEFEVAFANS |
| Ga0257146_10457731 | 3300026374 | Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTN |
| Ga0257172_11072002 | 3300026482 | Soil | LKKQKKKGGKLLVDLVKLAKIAISPILGKGLAEFEVAFTNP |
| Ga0257160_10075283 | 3300026489 | Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGNGLAEFEVAFT |
| Ga0257181_10595882 | 3300026499 | Soil | KKKGGKLPVDLVKLAKIAISPILGKGLAEFEVAFTNP |
| Ga0208369_10211041 | 3300026998 | Forest Soil | LKRQKKREGRLPVNLVKLAEIAISPVLGKGLAEVEV |
| Ga0209730_10366421 | 3300027034 | Forest Soil | KRQKKKGGKLPLDLVKLAKIAISPVLRKKGLAEFEVAFTNPVAHRL |
| Ga0208366_10029891 | 3300027073 | Forest Soil | RKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTNP |
| Ga0207948_10035962 | 3300027174 | Forest Soil | LKRQKKKEAKLLVDLVKLAKLAISPVLGKGLAEFEVAFANP |
| Ga0209331_11586272 | 3300027603 | Forest Soil | LKKQKKKGGKLPVDLVKLAKTAISPVLEKGLAEFEVALTNP |
| Ga0209579_102456401 | 3300027869 | Surface Soil | RLKGQKKKGGKQGVNLVKLAKIAISPVLGKGLIEFEVAFTNP |
| Ga0209283_109211442 | 3300027875 | Vadose Zone Soil | QKKKCGKLPVDLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Ga0209275_102807242 | 3300027884 | Soil | LKRQKKKGGKLPVDLVKLAKIAISPVLGKGLAEFEVAF |
| Ga0209380_101663143 | 3300027889 | Soil | KRRAIRKRLKRQKNKGGKLLVDLVKLAKIAISPVLGKGPAEFKVAFTNP |
| Ga0207428_105643533 | 3300027907 | Populus Rhizosphere | LKRQKKKGGKLVKLAKIAISPAVGKGLAESEVAFT |
| Ga0265351_10058922 | 3300028020 | Soil | TIRKRLKGQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFANP |
| Ga0265357_10365032 | 3300028023 | Rhizosphere | LKRQKKKGGKLLVDLVKLVEIAISPVLRKGLAEFEVAFTIQ |
| Ga0073994_100027681 | 3300030991 | Soil | NKKGGKLPVDLVKLAKIAISPVLGKGLAEFEVAFPNP |
| Ga0310686_1079588062 | 3300031708 | Soil | MRLKRQRKKGGKLLVDLVKLAKIAISPVLGRGLAEFEGPF |
| Ga0307476_111887891 | 3300031715 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFE |
| Ga0307474_100781533 | 3300031718 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNPVADLL |
| Ga0307474_107966141 | 3300031718 | Hardwood Forest Soil | RTIRKRLKRQKKKGGKLLVDLVKLVEIAISPVLRKKGLAAFEVAFTNPVPHLL |
| Ga0307474_108291121 | 3300031718 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFANP |
| Ga0307469_105610452 | 3300031720 | Hardwood Forest Soil | LKRQMKKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTNPVPHLL |
| Ga0307475_101697413 | 3300031754 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLVEIAISPVLKKKGLAEFEEAFTNPVAHLL |
| Ga0307473_102960022 | 3300031820 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTNPVPHLL |
| Ga0307473_105784442 | 3300031820 | Hardwood Forest Soil | KGGKQPVDLVKLVEIAISPVLGKGLAEFEEAFTNPVVHLL |
| Ga0307479_102950853 | 3300031962 | Hardwood Forest Soil | LKGQKKKGPKVLVNFVKLAKIAISPVLGKAEAEFEVGFYDPLIFRPIQV |
| Ga0307479_105763772 | 3300031962 | Hardwood Forest Soil | MKKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTNPVAPLL |
| Ga0307479_107056562 | 3300031962 | Hardwood Forest Soil | SKRLKRQKKKGGKLLVDLVKLVEIAISPILRKGLAEFEEAFTNPAAHL |
| Ga0307479_115270291 | 3300031962 | Hardwood Forest Soil | MKRQKKTGGKLLVDLVKLAKIAISPVLGKGLAEFEVAFTNP |
| Ga0307479_116960901 | 3300031962 | Hardwood Forest Soil | TIRKRLKRQKKKGGKLLVDLVKLVEIAISPVLRKKGLAAFEVAFTNPVAHLL |
| Ga0307479_121024241 | 3300031962 | Hardwood Forest Soil | MKNGGKLFVDLVKLAEIAISPVLGKGLAEFEVAFTNPIAPLL |
| Ga0307470_100409373 | 3300032174 | Hardwood Forest Soil | LKRQKKKGGNLLVDLVKLVEIAISPVLGNGVAEFEEAFTNPVAHLL |
| Ga0307471_1023989292 | 3300032180 | Hardwood Forest Soil | LKRQKKKGGKLLVDLVKLVEIAISPVLRKDLAEFEEAFTNPVAHLL |
| Ga0307471_1034771052 | 3300032180 | Hardwood Forest Soil | RKKGGKLLADLVKLAKIAISPVPGKGPAEFEVAFTNP |
| Ga0307471_1038103491 | 3300032180 | Hardwood Forest Soil | LKRQKKKGEKLLVDLVKLAEIAISPVFGKGLAEFEVAFTNP |
| Ga0307472_1004205573 | 3300032205 | Hardwood Forest Soil | KLLVDLVKLAEIAISPVLGKGLAEFEVAFTNSVAHLR |
| Ga0307472_1008569491 | 3300032205 | Hardwood Forest Soil | MKKGGKLLVDLVKLAEIAISPVLGKGLAEFEVAFTN |
| ⦗Top⦘ |