


| Basic Information | |
|---|---|
| Family ID | F092572 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LLLLHNFDWFPWYRISQFFWPAILIGAGVLMMRNRLDRRS |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.187 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.187 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.598 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13349 | DUF4097 | 8.41 |
| PF00275 | EPSP_synthase | 5.61 |
| PF13345 | Obsolete Pfam Family | 1.87 |
| PF00486 | Trans_reg_C | 0.93 |
| PF00291 | PALP | 0.93 |
| PF04185 | Phosphoesterase | 0.93 |
| PF04397 | LytTR | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004120|Ga0058901_1481167 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005184|Ga0066671_10175794 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300005434|Ga0070709_11530977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 542 | Open in IMG/M |
| 3300005454|Ga0066687_10813497 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005537|Ga0070730_11012409 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005546|Ga0070696_100942117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 718 | Open in IMG/M |
| 3300005554|Ga0066661_10020564 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300005586|Ga0066691_10397697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300005598|Ga0066706_10184884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| 3300005602|Ga0070762_10439512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 847 | Open in IMG/M |
| 3300005841|Ga0068863_101615987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 657 | Open in IMG/M |
| 3300005921|Ga0070766_10423598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 875 | Open in IMG/M |
| 3300006050|Ga0075028_100275821 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300006102|Ga0075015_100135477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300006173|Ga0070716_101118158 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006176|Ga0070765_100421854 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300006954|Ga0079219_10643381 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300007258|Ga0099793_10054688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300007258|Ga0099793_10434786 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009038|Ga0099829_10866082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300009089|Ga0099828_10949614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300009089|Ga0099828_11938367 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010325|Ga0134064_10215600 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010336|Ga0134071_10675020 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010358|Ga0126370_10574810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300010366|Ga0126379_10222596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1834 | Open in IMG/M |
| 3300010396|Ga0134126_10348372 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300011271|Ga0137393_10564760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300011271|Ga0137393_11166408 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300011271|Ga0137393_11401948 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012200|Ga0137382_11167168 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012203|Ga0137399_10060635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2796 | Open in IMG/M |
| 3300012203|Ga0137399_11156070 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012205|Ga0137362_10412081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300012205|Ga0137362_11586266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012208|Ga0137376_10067178 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300012212|Ga0150985_107226353 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012351|Ga0137386_10920793 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012356|Ga0137371_11160598 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012357|Ga0137384_10120353 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300012361|Ga0137360_10290169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300012361|Ga0137360_10712516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012361|Ga0137360_11897694 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012362|Ga0137361_10566413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300012362|Ga0137361_11569735 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012469|Ga0150984_122273189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300012923|Ga0137359_10550461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300012924|Ga0137413_10291406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300012925|Ga0137419_10641735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300012925|Ga0137419_11008100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012927|Ga0137416_10340034 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012927|Ga0137416_11811501 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012929|Ga0137404_11281252 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012944|Ga0137410_10935724 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012972|Ga0134077_10180449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300013297|Ga0157378_10001974 | All Organisms → cellular organisms → Bacteria | 18343 | Open in IMG/M |
| 3300014201|Ga0181537_10603726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300015054|Ga0137420_1080018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300015054|Ga0137420_1177690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300015241|Ga0137418_10245857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1521 | Open in IMG/M |
| 3300015241|Ga0137418_10472970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300015242|Ga0137412_10000856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22731 | Open in IMG/M |
| 3300018433|Ga0066667_11729489 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018482|Ga0066669_10012003 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
| 3300020140|Ga0179590_1113056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300020170|Ga0179594_10054496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300020170|Ga0179594_10183709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300020579|Ga0210407_10147994 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300020580|Ga0210403_10052518 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
| 3300020581|Ga0210399_11299083 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300021170|Ga0210400_10070865 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300021171|Ga0210405_10095583 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300021178|Ga0210408_11106650 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021180|Ga0210396_11209201 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021402|Ga0210385_11283331 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021405|Ga0210387_10618155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300021479|Ga0210410_10444338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1160 | Open in IMG/M |
| 3300021479|Ga0210410_11804425 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021559|Ga0210409_10220011 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300021560|Ga0126371_11910352 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300022507|Ga0222729_1072630 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300024284|Ga0247671_1031492 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300025939|Ga0207665_10732105 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026325|Ga0209152_10028078 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300026334|Ga0209377_1231333 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300027587|Ga0209220_1193338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300027645|Ga0209117_1019788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2183 | Open in IMG/M |
| 3300027875|Ga0209283_10510686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300027903|Ga0209488_10955839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300027903|Ga0209488_11137851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300028047|Ga0209526_10079650 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300028047|Ga0209526_10209519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300028536|Ga0137415_10578184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300028536|Ga0137415_10652095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300028800|Ga0265338_10777362 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300028906|Ga0308309_10038699 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300028906|Ga0308309_10211795 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300030991|Ga0073994_10050136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300030991|Ga0073994_10060724 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300030991|Ga0073994_12380860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300031057|Ga0170834_100388050 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031823|Ga0307478_11252872 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031823|Ga0307478_11617991 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031823|Ga0307478_11711377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031962|Ga0307479_11037704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300032180|Ga0307471_103991379 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032205|Ga0307472_101328343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058901_14811672 | 3300004120 | Forest Soil | LLIGAGVLLMLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0066671_101757943 | 3300005184 | Soil | GAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0070709_115309772 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IGILLLLHNFDWFPWWRIQQFWPLLLIAVGILMFRNRLGGR* |
| Ga0066687_108134972 | 3300005454 | Soil | LLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0070730_110124093 | 3300005537 | Surface Soil | LLLLHNFDWFPWWRIQQFWPLILIALGVFMFRNRLGGRR* |
| Ga0070696_1009421171 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LIIGVGVLLLLHNFDWFPWWRIQQFWPVLLIVVGVVMFRNRLGGGRP* |
| Ga0066661_100205644 | 3300005554 | Soil | LLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRP* |
| Ga0066691_103976971 | 3300005586 | Soil | HNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS* |
| Ga0066706_101848841 | 3300005598 | Soil | IGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS* |
| Ga0070762_104395123 | 3300005602 | Soil | HNFDWFPWWRIQQFWPLILIALGIFMFRNRLGGRQ* |
| Ga0068863_1016159873 | 3300005841 | Switchgrass Rhizosphere | RPVGPMLIIGVGVLLLLHNFDWFPWWRIQQFWPVLLIVVGVVMFRNRLGGGRP* |
| Ga0070766_104235981 | 3300005921 | Soil | LIIAIGILLLLHNFDWFPWWRVQQFWPVILIVVGVLMFRRRLGGRP* |
| Ga0075028_1002758213 | 3300006050 | Watersheds | IIGVGVLLLLHNFDWFPFWRLQQFWPVLLIAAGILMFRNRMGGRS* |
| Ga0075015_1001354773 | 3300006102 | Watersheds | LLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRP* |
| Ga0070716_1011181581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR* |
| Ga0070765_1004218541 | 3300006176 | Soil | IAIGILLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRQRLGRRP* |
| Ga0079219_106433811 | 3300006954 | Agricultural Soil | LLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGGR* |
| Ga0099793_100546883 | 3300007258 | Vadose Zone Soil | FDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRP* |
| Ga0099793_104347863 | 3300007258 | Vadose Zone Soil | GILLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRP* |
| Ga0099829_108660823 | 3300009038 | Vadose Zone Soil | LLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRP* |
| Ga0099828_109496143 | 3300009089 | Vadose Zone Soil | LHNFDWFPWYRISQFFWPVVLIGAGVLMMRKRLDRRS* |
| Ga0099828_119383672 | 3300009089 | Vadose Zone Soil | FDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0134064_102156001 | 3300010325 | Grasslands Soil | RPIGPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0134071_106750203 | 3300010336 | Grasslands Soil | LLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS* |
| Ga0126370_105748103 | 3300010358 | Tropical Forest Soil | GVLLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRNRLSGRS* |
| Ga0126379_102225963 | 3300010366 | Tropical Forest Soil | VLLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRNRLSGRS* |
| Ga0134126_103483723 | 3300010396 | Terrestrial Soil | RPIGPILLIGAGLLLLLNNFDWFPWYRITQFFFPAILIGVGILMFRNRMNRGK* |
| Ga0137393_105647601 | 3300011271 | Vadose Zone Soil | FSKGKPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGGR* |
| Ga0137393_111664081 | 3300011271 | Vadose Zone Soil | FDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0137393_114019481 | 3300011271 | Vadose Zone Soil | NFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0137382_111671682 | 3300012200 | Vadose Zone Soil | GPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0137399_100606351 | 3300012203 | Vadose Zone Soil | LLLLHNFDWFPWYRISQFFWPAILIGAGVLMMRNRLDRRS* |
| Ga0137399_111560703 | 3300012203 | Vadose Zone Soil | PIGPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0137362_104120811 | 3300012205 | Vadose Zone Soil | LLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRP* |
| Ga0137362_115862662 | 3300012205 | Vadose Zone Soil | PVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR* |
| Ga0137376_100671784 | 3300012208 | Vadose Zone Soil | GAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS* |
| Ga0150985_1072263533 | 3300012212 | Avena Fatua Rhizosphere | GILLLLHNFDWFPWWRIQQFWPVLLIVVGLVMFRNRLEG* |
| Ga0137386_109207931 | 3300012351 | Vadose Zone Soil | LLIGAGLLLLLHNFDWFPWYRISQFFWPIVLIGAGVLMMRKRLDRRS* |
| Ga0137371_111605983 | 3300012356 | Vadose Zone Soil | LHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS* |
| Ga0137384_101203531 | 3300012357 | Vadose Zone Soil | HNFDWFPWYRISQFFWPIVLIGAGVLMMRKRLDRRS* |
| Ga0137360_102901691 | 3300012361 | Vadose Zone Soil | KPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPVPLILLGVLMFRNRLGGR* |
| Ga0137360_107125161 | 3300012361 | Vadose Zone Soil | GKPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGDR* |
| Ga0137360_118976941 | 3300012361 | Vadose Zone Soil | GKPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIIVGLLMFRNRLEGR* |
| Ga0137361_105664131 | 3300012362 | Vadose Zone Soil | IGIGILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGDR* |
| Ga0137361_115697353 | 3300012362 | Vadose Zone Soil | IGPILLIGAGLLLLLHNFDWFPWYRISQFFWPIVLIGAGVLMMRKRLDRRS* |
| Ga0150984_1222731891 | 3300012469 | Avena Fatua Rhizosphere | LLLLHNFDWFPWWRIQQFWPVLLIVAGVVMFRNRLGGGRL* |
| Ga0137359_105504611 | 3300012923 | Vadose Zone Soil | LIIGIGILLLLHNFDWFPWWRIQQFWPVLLIIVGLLMFRNRLEGR* |
| Ga0137413_102914063 | 3300012924 | Vadose Zone Soil | LHNFDWFPWYRISQFFWPALLIGAGVLMMRNRLDRRS* |
| Ga0137419_106417351 | 3300012925 | Vadose Zone Soil | LLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRNRLDRRP* |
| Ga0137419_110081003 | 3300012925 | Vadose Zone Soil | LLLHNFDWFPWWRIQQFWPVLLIVLGVFMFRNRLGGR* |
| Ga0137416_103400343 | 3300012927 | Vadose Zone Soil | KPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR* |
| Ga0137416_118115013 | 3300012927 | Vadose Zone Soil | GPFLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGRERGRHGE* |
| Ga0137404_112812523 | 3300012929 | Vadose Zone Soil | VLLLLHNFDWFPWYRLSQFFWPAVLLAAGVLMMRNRLDRRS* |
| Ga0137410_109357243 | 3300012944 | Vadose Zone Soil | LHNFDWFPWYRVSQFWPLILIAVGILMFRNRIDRRS* |
| Ga0134077_101804491 | 3300012972 | Grasslands Soil | PVGPIILIALGVFLLLSKFDWFPWYRISQFFWPLLLIGAGIWMMRNRLDRRS* |
| Ga0157378_1000197416 | 3300013297 | Miscanthus Rhizosphere | VLLLLHNFDWFPWWRIQQFWPVLLIVVGVVMFRNRLGGGRP* |
| Ga0181537_106037263 | 3300014201 | Bog | LLLHNFDWFPWWRIQQFWPLILIALGIFMFRNRLGGRQ* |
| Ga0137420_10800183 | 3300015054 | Vadose Zone Soil | PILLIGAGLLMLLHNFDWFPWYRISQFFWPALLIGAGVLMMRKRLDRRS* |
| Ga0137420_11776901 | 3300015054 | Vadose Zone Soil | FDWFPWYRISQFFWPALLIGAGVLMMRKRLDRRS* |
| Ga0137418_102458573 | 3300015241 | Vadose Zone Soil | GAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0137418_104729703 | 3300015241 | Vadose Zone Soil | LLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0137412_100008561 | 3300015242 | Vadose Zone Soil | HNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS* |
| Ga0066667_117294893 | 3300018433 | Grasslands Soil | LIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0066669_100120031 | 3300018482 | Grasslands Soil | LLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0179590_11130563 | 3300020140 | Vadose Zone Soil | GPFLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR |
| Ga0179594_100544961 | 3300020170 | Vadose Zone Soil | VLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS |
| Ga0179594_101837091 | 3300020170 | Vadose Zone Soil | GPILLIGAGLLLLLHNFDWFPWYRISQFFWPALLIGAGVLMMRKRLDRRS |
| Ga0210407_101479941 | 3300020579 | Soil | LIIAIGILLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRKRLGGRP |
| Ga0210403_100525181 | 3300020580 | Soil | KGKPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGGR |
| Ga0210399_112990833 | 3300020581 | Soil | LLMLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0210400_100708654 | 3300021170 | Soil | GAGVLLMLHNFDWFPWYRISQFFWPALLIGAGVLMMRNRLDRRP |
| Ga0210405_100955834 | 3300021171 | Soil | LLLHNFDWFPWWRIQQFWPVILIVVGVLMFRQRLGGRP |
| Ga0210408_111066501 | 3300021178 | Soil | HNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0210396_112092013 | 3300021180 | Soil | LIIGIGILLLLHNFDWFPWWRIQQFWPVLLIIVGVLMFRNRLGNR |
| Ga0210385_112833312 | 3300021402 | Soil | LLLLHNFDWFPWWRIQQFWPLILIALGVFMFRNRLGGGRQ |
| Ga0210387_106181551 | 3300021405 | Soil | HNFDWFPWWRIQQFWPVILIVVGVLMFRQRLGGRP |
| Ga0210410_104443383 | 3300021479 | Soil | LIGAGLLLLLNNFDWFPWYRVSQFWPLILIAVGILMFRNRIDRRS |
| Ga0210410_118044252 | 3300021479 | Soil | ILLLLHNFDWFPWWRIQQFWPVLLIIVGLMMFRNRLEGR |
| Ga0210409_102200111 | 3300021559 | Soil | ILLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRQRLGGRP |
| Ga0126371_119103523 | 3300021560 | Tropical Forest Soil | GVLLLLNKFDWFPWYRVSQFFFPALLIGIGIIMFRNRMDGRP |
| Ga0222729_10726301 | 3300022507 | Soil | PILLIGAGLLLLLNNFDWFPWYRVSQFWPLILIAVGILMFRNRVNRQP |
| Ga0247671_10314921 | 3300024284 | Soil | ILLIGAGLLLLLNNFDWFPWYRITQFFFPAILIGVGILMFRNRMNRGK |
| Ga0207665_107321053 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR |
| Ga0209152_100280781 | 3300026325 | Soil | LLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0209377_12313333 | 3300026334 | Soil | LLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS |
| Ga0209220_11933381 | 3300027587 | Forest Soil | LLLLHNFDWFPWWRIQQFWPVLLIIVGLLMFRNRLGGR |
| Ga0209117_10197884 | 3300027645 | Forest Soil | PIGPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS |
| Ga0209283_105106863 | 3300027875 | Vadose Zone Soil | LHNFDWFPWYRISQFFWPVVLIGAGVLMMRKRLDRRS |
| Ga0209488_109558391 | 3300027903 | Vadose Zone Soil | FSKGKPVGPFLIIGIGILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGDR |
| Ga0209488_111378511 | 3300027903 | Vadose Zone Soil | FLIIGIGILLLLHNFDWFPWWRIQQFWPVLLIVLGVLMFRNRLGGR |
| Ga0209526_100796503 | 3300028047 | Forest Soil | LLHNFDWFPWWRIQQFWPVLLIVVGLLMFRNRLEGR |
| Ga0209526_102095191 | 3300028047 | Forest Soil | VGPFLIIAIGILLLLHNFDWFPWWRIQQFWPVVLIVVGVVMFRNRLGGRL |
| Ga0137415_105781841 | 3300028536 | Vadose Zone Soil | LLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS |
| Ga0137415_106520951 | 3300028536 | Vadose Zone Soil | GAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS |
| Ga0265338_107773622 | 3300028800 | Rhizosphere | FIGILLLLHNFDWFPWWRIQQFWPLILIALGIFMFRNRLGNRQ |
| Ga0308309_100386991 | 3300028906 | Soil | LLLHNFDWFPWWRIQQFWPLILIALGIFMFRNRLGGRQ |
| Ga0308309_102117951 | 3300028906 | Soil | NNFDWFPWYRISQFWPLILIAVGILMFRNRMNRQQ |
| Ga0073994_100501361 | 3300030991 | Soil | PIGPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIAVGVLMMRKRLDRRS |
| Ga0073994_100607241 | 3300030991 | Soil | GPILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRS |
| Ga0073994_123808603 | 3300030991 | Soil | LLLLHNFDWFPWYRISQFFWPAVLIAAGVLMMRKRLDRRP |
| Ga0170834_1003880501 | 3300031057 | Forest Soil | PIGPILLIGAGVLLMLHNFDWFPWYRISQFFWPAVLIAAGVLMMRNRLDRRS |
| Ga0307478_112528723 | 3300031823 | Hardwood Forest Soil | LLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGDR |
| Ga0307478_116179913 | 3300031823 | Hardwood Forest Soil | HNFDWFPWYRISQFFWPAILIGVGVLMLRNRLDRRP |
| Ga0307478_117113771 | 3300031823 | Hardwood Forest Soil | IIAIGILLLLHNFDWFPWWRIQQFWPVILIVVGVLMFRKRLGGRP |
| Ga0307479_110377041 | 3300031962 | Hardwood Forest Soil | ILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRKRLDRRS |
| Ga0307471_1039913791 | 3300032180 | Hardwood Forest Soil | PILLIGAGVLLLLHNFDWFPWYRISQFFWPAVLIGAGVLMMRNRLDRRS |
| Ga0307472_1013283431 | 3300032205 | Hardwood Forest Soil | ILLLLHNFDWFPWWRIQQFWPIILIIVGLLMFKNRLGGR |
| ⦗Top⦘ |