


| Basic Information | |
|---|---|
| Family ID | F092514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MRPEEGTYLAHRQGNPLLGLLPREHAHFGLRREHRGLHGDGVRMRRDIIR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.26 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.785 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (14.953 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.187 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF08238 | Sel1 | 6.54 |
| PF04392 | ABC_sub_bind | 3.74 |
| PF13091 | PLDc_2 | 2.80 |
| PF08450 | SGL | 2.80 |
| PF04909 | Amidohydro_2 | 2.80 |
| PF12681 | Glyoxalase_2 | 2.80 |
| PF00614 | PLDc | 1.87 |
| PF00903 | Glyoxalase | 1.87 |
| PF00296 | Bac_luciferase | 1.87 |
| PF13531 | SBP_bac_11 | 1.87 |
| PF03401 | TctC | 0.93 |
| PF04471 | Mrr_cat | 0.93 |
| PF01436 | NHL | 0.93 |
| PF07635 | PSCyt1 | 0.93 |
| PF06736 | TMEM175 | 0.93 |
| PF00583 | Acetyltransf_1 | 0.93 |
| PF01042 | Ribonuc_L-PSP | 0.93 |
| PF17170 | DUF5128 | 0.93 |
| PF01546 | Peptidase_M20 | 0.93 |
| PF13646 | HEAT_2 | 0.93 |
| PF01738 | DLH | 0.93 |
| PF02163 | Peptidase_M50 | 0.93 |
| PF00486 | Trans_reg_C | 0.93 |
| PF08818 | DUF1801 | 0.93 |
| PF13360 | PQQ_2 | 0.93 |
| PF04187 | Cofac_haem_bdg | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| PF05163 | DinB | 0.93 |
| PF02661 | Fic | 0.93 |
| PF13420 | Acetyltransf_4 | 0.93 |
| PF01883 | FeS_assembly_P | 0.93 |
| PF09720 | Unstab_antitox | 0.93 |
| PF06452 | CBM9_1 | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF13618 | Gluconate_2-dh3 | 0.93 |
| PF08447 | PAS_3 | 0.93 |
| PF07366 | SnoaL | 0.93 |
| PF01583 | APS_kinase | 0.93 |
| PF07394 | DUF1501 | 0.93 |
| PF12821 | ThrE_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.74 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.80 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.80 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 1.87 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.87 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.93 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 0.93 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.93 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.93 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_111958956 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300002073|JGI24745J21846_1005594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1373 | Open in IMG/M |
| 3300004081|Ga0063454_101511102 | Not Available | 575 | Open in IMG/M |
| 3300004092|Ga0062389_102594744 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004119|Ga0058887_1010438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300004120|Ga0058901_1002302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300004157|Ga0062590_100559961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 993 | Open in IMG/M |
| 3300004480|Ga0062592_100543814 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 972 | Open in IMG/M |
| 3300005163|Ga0066823_10026812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300005174|Ga0066680_10577410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300005187|Ga0066675_10233365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. FACHB-SPT15 | 1307 | Open in IMG/M |
| 3300005343|Ga0070687_100016896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 3342 | Open in IMG/M |
| 3300005444|Ga0070694_100142299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1743 | Open in IMG/M |
| 3300005445|Ga0070708_101303083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300005536|Ga0070697_101664705 | Not Available | 571 | Open in IMG/M |
| 3300005547|Ga0070693_100154496 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300005577|Ga0068857_100074414 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
| 3300005577|Ga0068857_102485647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 509 | Open in IMG/M |
| 3300005618|Ga0068864_102363452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005921|Ga0070766_11027009 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006046|Ga0066652_101702045 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006052|Ga0075029_100244788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300006174|Ga0075014_100853591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 542 | Open in IMG/M |
| 3300006176|Ga0070765_100664628 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300006177|Ga0075362_10501677 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006358|Ga0068871_100170736 | Not Available | 1864 | Open in IMG/M |
| 3300006847|Ga0075431_101662937 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006852|Ga0075433_10795204 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300006854|Ga0075425_102188759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 616 | Open in IMG/M |
| 3300006904|Ga0075424_102660698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300006904|Ga0075424_102807102 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009481|Ga0114932_10793640 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009700|Ga0116217_10971737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300014325|Ga0163163_11140220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia thailandensis | 842 | Open in IMG/M |
| 3300016341|Ga0182035_10538647 | Not Available | 1002 | Open in IMG/M |
| 3300016404|Ga0182037_10569042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 958 | Open in IMG/M |
| 3300016445|Ga0182038_10185624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300018054|Ga0184621_10191083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300018061|Ga0184619_10369259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300018079|Ga0184627_10548700 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018081|Ga0184625_10617649 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300018082|Ga0184639_10460444 | Not Available | 650 | Open in IMG/M |
| 3300018468|Ga0066662_10168474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1684 | Open in IMG/M |
| 3300018468|Ga0066662_10347659 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300019362|Ga0173479_10707957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 544 | Open in IMG/M |
| 3300019786|Ga0182025_1362784 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300020458|Ga0211697_10161146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300021170|Ga0210400_10185413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300021178|Ga0210408_11443520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 517 | Open in IMG/M |
| 3300021181|Ga0210388_11449727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021420|Ga0210394_11426553 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300021432|Ga0210384_10723911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300021433|Ga0210391_11127495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300022504|Ga0242642_1023236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300022531|Ga0242660_1052415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300022722|Ga0242657_1054107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300022726|Ga0242654_10208868 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025157|Ga0209399_10039308 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300025320|Ga0209171_10246732 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025911|Ga0207654_10379457 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025911|Ga0207654_10617860 | Not Available | 774 | Open in IMG/M |
| 3300025915|Ga0207693_10921165 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025916|Ga0207663_10521682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 925 | Open in IMG/M |
| 3300025938|Ga0207704_10493413 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300025942|Ga0207689_10256565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1446 | Open in IMG/M |
| 3300026023|Ga0207677_11821802 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026298|Ga0209236_1042414 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300026317|Ga0209154_1328255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027176|Ga0208992_1019045 | Not Available | 885 | Open in IMG/M |
| 3300027684|Ga0209626_1155158 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10284947 | Not Available | 595 | Open in IMG/M |
| 3300027842|Ga0209580_10106908 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300027854|Ga0209517_10634380 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027903|Ga0209488_10048416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3125 | Open in IMG/M |
| 3300028381|Ga0268264_10034478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. cf046 | 4163 | Open in IMG/M |
| 3300028828|Ga0307312_10757568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300029943|Ga0311340_10165150 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300030738|Ga0265462_11335355 | Not Available | 653 | Open in IMG/M |
| 3300031226|Ga0307497_10297560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300031236|Ga0302324_100167907 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
| 3300031474|Ga0170818_105513532 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300031545|Ga0318541_10317587 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300031588|Ga0302137_1291249 | Not Available | 536 | Open in IMG/M |
| 3300031708|Ga0310686_106925536 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300031718|Ga0307474_11482292 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031720|Ga0307469_10437757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300031740|Ga0307468_100879360 | Not Available | 774 | Open in IMG/M |
| 3300031781|Ga0318547_10526509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300031781|Ga0318547_10913669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300031820|Ga0307473_11485863 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031854|Ga0310904_10318355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 992 | Open in IMG/M |
| 3300031858|Ga0310892_11330064 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031890|Ga0306925_10891707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300031890|Ga0306925_11349123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300031912|Ga0306921_10234325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
| 3300031954|Ga0306926_10716529 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300032009|Ga0318563_10453585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium tropiciagri | 693 | Open in IMG/M |
| 3300032075|Ga0310890_10450865 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 967 | Open in IMG/M |
| 3300032075|Ga0310890_11578089 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032179|Ga0310889_10385245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
| 3300032180|Ga0307471_101348819 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300032421|Ga0310812_10187816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300033289|Ga0310914_11316001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300033812|Ga0364926_118554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300034149|Ga0364929_0030792 | Not Available | 1587 | Open in IMG/M |
| 3300034149|Ga0364929_0211124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 645 | Open in IMG/M |
| 3300034178|Ga0364934_0327805 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.93% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.93% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1119589561 | 3300000956 | Soil | MRPMRAEEGTDLAHREWNPFFRFLPREHAHFGVRR |
| JGI24745J21846_10055941 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVWMRGDIIGQDQY |
| Ga0063454_1015111021 | 3300004081 | Soil | MRSKEGTYLAHRQGNPLLWLFPWEHAHFGLRREHRGLHGDGVWMR |
| Ga0062389_1025947441 | 3300004092 | Bog Forest Soil | MRLQEGTYLTHRQGNPFLGLLPRVNAYFGFRREHRALHGNCVRMGRDVVRQDQDGRLAMA |
| Ga0058887_10104381 | 3300004119 | Forest Soil | MCPEEGMDLAHRQGNPLLRLLPWEHAYFSLWRQHRGLHGHGERMRRDIIRQDQ |
| Ga0058901_10023022 | 3300004120 | Forest Soil | MYLAHRQGNPLLGLLPREHTHFGLGREHRGLHGDGVRMRRDIIRQD |
| Ga0062590_1005599611 | 3300004157 | Soil | MRPEEGTYLAHRQGDPFFGFFPWEHAHFGLRREHRGLHGD |
| Ga0062592_1005438142 | 3300004480 | Soil | MRPEEGTYLAHRQGDPFFGFFPWEHAHFGLRREHRGLHGDGV |
| Ga0066823_100268121 | 3300005163 | Soil | MRAKERMYLAHRQGNPLLGLLPREHAHFGLRREHRGLHGDGV |
| Ga0066680_105774102 | 3300005174 | Soil | MYLAHRQGNPLLGLLPREHAHFGVWREHRGLHGHGVRMRR |
| Ga0066675_102333653 | 3300005187 | Soil | MRPEEGTYLAHRQGNPLLRLLPREHAHFRLGREHRGLHGDGVRMRRGIIRQD |
| Ga0070687_1000168963 | 3300005343 | Switchgrass Rhizosphere | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVW |
| Ga0070694_1001422991 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPEEGTYLAHRQGNPLLGLLPREHAHFRFWREHRGFHRNGVRMRRDIIRQDQYGRL |
| Ga0070708_1013030831 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKEGTYLAYRQRNPLLGLLPREHAHFGLRREHRGLHGDGVRMRGDIIRQDQ |
| Ga0070697_1016647051 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPKEGTYLAHCQWNPLLGLLPREHAHFGIRREHRGLHGDGVRMRRDIIRQ |
| Ga0070693_1001544963 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLEEGMDLAHRQGNPLFGLFPGEDAHFGFRRKHRTLHGYGVWMSRDIIRQDQYRRLA |
| Ga0068857_1000744141 | 3300005577 | Corn Rhizosphere | MRPEEGTYMAHRQGNPLLGLLPWVHAHFGLRREHRGLHG |
| Ga0068857_1024856471 | 3300005577 | Corn Rhizosphere | MRSEEGTYLAHRQGNPLLGLLPREHAHFGLRREHRGLH |
| Ga0068864_1023634521 | 3300005618 | Switchgrass Rhizosphere | MCAEEGTYLAHRQWNPLLGLLPGENAHFGLWREHRGLHGDGVRMR |
| Ga0070766_110270092 | 3300005921 | Soil | MCPQERMYLAHRKGNSLLGFLPREHAYFGVWREHRRLHGHGVWMRRD |
| Ga0066652_1017020451 | 3300006046 | Soil | VRPEEGTDLAHRQWNPFLRLLPREHTHFCLRREHRGLHG |
| Ga0075029_1002447882 | 3300006052 | Watersheds | MYLAHGQRNPLLGFLPREDAHFGLGREHGGLHGDGVRMRRDIIRQDQYG |
| Ga0075014_1008535911 | 3300006174 | Watersheds | MCPEEGTYLADRQGNPFLGFLPWEHTHFRIRREHGGFHGDG |
| Ga0070765_1006646282 | 3300006176 | Soil | MYLAHCQWNPLFGFFPRINAYFGFRRKHRALHGDDERMRRDIVRHNQYR |
| Ga0075362_105016771 | 3300006177 | Populus Endosphere | MGPKEGTNLANRERNPLLGLLPRKHAHFGVRREHRGLHGDFVRMRRDIV |
| Ga0068871_1001707362 | 3300006358 | Miscanthus Rhizosphere | MNLAHGQGNPLLGLFPGEHAYFGVGREHRALHRNGERMSRDIVRQDQDRVLA |
| Ga0075431_1016629371 | 3300006847 | Populus Rhizosphere | MGSEEGTYLTHCQGNPLLRLLPREHAHFCLRREHRGLHGDGVRMRRGIIRQ |
| Ga0075433_107952043 | 3300006852 | Populus Rhizosphere | MGPEERTYLAYRQGNPLLRLLPREHAHFSLRREHRGLHGDGVRMRRGIIRQD |
| Ga0075425_1021887591 | 3300006854 | Populus Rhizosphere | MRAEERTNLSHGQWNPFFGFFPWEHAHFSIGSEHRGLHSDGVRMRRNVVGQDQYRCLA |
| Ga0075424_1026606981 | 3300006904 | Populus Rhizosphere | MRPEERTYLTHGERNPFLGLLPREHAHFGLRRQHRGLHGDGVRMRGDIVRQDQDRR |
| Ga0075424_1028071021 | 3300006904 | Populus Rhizosphere | MRAKERMNLAHREGNALPGFFPWEHAHFGMRCEHCAFH |
| Ga0114932_107936402 | 3300009481 | Deep Subsurface | MRPEEGTYLAYRQWNPLWRLLPWEHADFGLRCEHRGLHGDGVRM |
| Ga0116217_109717371 | 3300009700 | Peatlands Soil | MYLAHRQGDPLLGLLPRENAHFGLWREHRGLHRDGVRMRRDIVRQLPAGRFSHTM |
| Ga0163163_111402201 | 3300014325 | Switchgrass Rhizosphere | VYLPHRQRNPLLGLLPWKYAHFGVRREHRGFHSDSVRM |
| Ga0182035_105386471 | 3300016341 | Soil | MRPKEGTYLTHCKGNPLLRLLPREDAHFGVRREHRGLHGDSVRMRRDIIGENQYG |
| Ga0182037_105690421 | 3300016404 | Soil | MYLADRQRNPLLRLLPGKYAHFGLRRQHRSLHGDGVRMRRDIVGED |
| Ga0182038_101856241 | 3300016445 | Soil | MCPEEGMNLAHGQGNPLLRLLLREHARFGIWHEHRRLHGDFVRMRR |
| Ga0184621_101910831 | 3300018054 | Groundwater Sediment | MRPEEGTYLAYRQGNPLLGLLPWEDAHFGLWREHRRLHGDGVRVRR |
| Ga0184619_103692591 | 3300018061 | Groundwater Sediment | MDLAHRQGNPLFGFFPGEHAHFGLWRDHRALHGDGVRMVRNIVWKDEYRCLARAHE |
| Ga0184627_105487001 | 3300018079 | Groundwater Sediment | MRPKEGTYLAHGQGNPLLGLLPREHAHFGLRREHRGLHGDGVRMRRDIIR |
| Ga0184625_106176491 | 3300018081 | Groundwater Sediment | MRPEEGTYLADRQGNPLLGLLPREHTHFGLRREHRGLHGDGVRMRRDIVRQDQDGR |
| Ga0184639_104604441 | 3300018082 | Groundwater Sediment | MRSEEGTYLAHRQGNPLLGLLPREHAHVGLRREHRGRHSDGVRMRRGIIRQDQYGRPAIA |
| Ga0066662_101684743 | 3300018468 | Grasslands Soil | MYLAHRQGNPLLGLLPREHAHFGVWREHRGLHGHGVRMRRD |
| Ga0066662_103476593 | 3300018468 | Grasslands Soil | VYLAHRQGNPLLGLLPREHAHFGVWREHRGLHGHGVRMRR |
| Ga0173479_107079572 | 3300019362 | Soil | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVWMRGDI |
| Ga0182025_13627844 | 3300019786 | Permafrost | MYLAHRQGNPFLGLLPREHAHFGIWREHRGLHGNGVRMRRDIVRQDQY |
| Ga0211697_101611461 | 3300020458 | Marine | MRPEEGPYLANRQGNPFPGLLPREHAHLGFRRQHSSLHCDRVRMRRDIVRQDQDRCLTLT |
| Ga0210400_101854132 | 3300021170 | Soil | MYLADRQGNPLLGLLPREYAHFGLGREHRGLHGDGVRVLRDIIRED |
| Ga0210408_114435201 | 3300021178 | Soil | MRPEEGTYLAHRQRNPLLRLLPRVNAYLGIRREHRGLHGDGVGMRRDIIRQDQYGRLA |
| Ga0210388_114497271 | 3300021181 | Soil | MNLAHRQGNPLLGLLPREHAHFGPLRKHRGLHGDGVRMR |
| Ga0210394_114265532 | 3300021420 | Soil | MNLAHRQGNPLLGLFPREDAHFGVGREHRGLHGDGVRMRRNVIW |
| Ga0210384_107239111 | 3300021432 | Soil | MCPEEGTYLAYGQGNPLLGLLPREDAHFGLGREHRRLHGDGVRMRRNIIRQD |
| Ga0210391_111274952 | 3300021433 | Soil | MYLAHRQGNPLLGLFPREHAHFGLWREHRGLHGDGVRMRRDIIRQDQYRRLAI |
| Ga0242642_10232361 | 3300022504 | Soil | MDLAHRQGNPLLGLLPREHAHFGLGREHRGLHGDGVGMRRDIIRQDQ |
| Ga0242660_10524152 | 3300022531 | Soil | MDLAHRQGNPLLGLLPREHAHFGLWREHRGLHGHGVGMRRDIVRQDQYGRLAIA |
| Ga0242657_10541071 | 3300022722 | Soil | MDLAHRQGNPLLGLLPREHAHFGLWREHRGLHGHGVGMCRDIVRHDQYGRLAIAHEI |
| Ga0242654_102088681 | 3300022726 | Soil | MDLAHRQRNPLLGLLPREHTHFGLGREHRGLHGDGVGMRRDIIRQDQYG |
| Ga0209399_100393081 | 3300025157 | Thermal Springs | MGSEERTDLAHRQGNPLFGLLPREHAYFGFGREHRGLHGDGIR |
| Ga0209171_102467322 | 3300025320 | Iron-Sulfur Acid Spring | MGLQKGTYLAHRQGNPLLGLLPRVNAYFGLRREHRALHGDSVRMRRDIVRQNQYGRLAI |
| Ga0207654_103794572 | 3300025911 | Corn Rhizosphere | LAHRQGNPLLGLLPREHAHFGLRREHRGLHRDSVRMR |
| Ga0207654_106178601 | 3300025911 | Corn Rhizosphere | MRSKEGTYLAHRQGNPLLWLFPWEHAHFGFRREHRGLHGDGVWMRRDIIWED |
| Ga0207693_109211651 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MYLAYRQGNSLLGLLPRKDAHFGVGCEHRGLHGDGVRMRRDIIRQDQDGR |
| Ga0207663_105216822 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVWMRGDIIGQDQYGH |
| Ga0207704_104934133 | 3300025938 | Miscanthus Rhizosphere | MRPEEGTYLAHRQGNPLLGLLPREHAHFGLRREHRGLHGDGVRMRRDIIR |
| Ga0207689_102565652 | 3300025942 | Miscanthus Rhizosphere | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVWMRGDIIGQD |
| Ga0207677_118218022 | 3300026023 | Miscanthus Rhizosphere | MCAEEGTYLAHRQRNPLLGLLPGENAHFGLWREHRGL |
| Ga0209236_10424144 | 3300026298 | Grasslands Soil | MCPEEGTYLAHRQGNPLLGLLPREHAHFGLWREHRGLHGDGVR |
| Ga0209154_13282551 | 3300026317 | Soil | MDLAHRQGDPLLGLLPREHAHFGVWREHRGLHGDGVRMRRDIIRQ |
| Ga0208992_10190452 | 3300027176 | Forest Soil | MDLAYRQRDPLLGLFPGEHADLGLRRQHRGFHGDGVGMRRDIV |
| Ga0209626_11551581 | 3300027684 | Forest Soil | MDLAHGQRDTVLGLLPWEHADFGLGGEHRGLHGYGVGMC |
| (restricted) Ga0255041_102849471 | 3300027837 | Seawater | MCSEEGTYLAYRQGNTLRGLLPREQAHFSLGRQHRSFHG |
| Ga0209580_101069081 | 3300027842 | Surface Soil | MYLAHRQRNSFLGLLPREDAHFGLRREHRGLHGHGVWM |
| Ga0209517_106343802 | 3300027854 | Peatlands Soil | MDLADRERNPLFGLFPGEDAHFGFRREQRALHGDGVRMRRDIIRQDQYGSLAI |
| Ga0209488_100484161 | 3300027903 | Vadose Zone Soil | MCPEEGTYLAHRQGNPLLGLLPRENAHFGLWREHRGLHGDGVRMRR |
| Ga0268264_100344781 | 3300028381 | Switchgrass Rhizosphere | MRSEEGTYLAHRQGNPLLGLFPGEHAHFGLRREHRGLHGDGVWMRGDIIGQDQ |
| Ga0307312_107575682 | 3300028828 | Soil | MRLEEGTYLAHSQGNALLGFLPREHAHLSFRREHRGLHGDGVRMRRDIVRQDQYRRL |
| Ga0311340_101651501 | 3300029943 | Palsa | MDLAHRQGNPLLGLFPREHAHFGLWREHRRLHGDGVRMRRNIIRQDQYGRLAIAD |
| Ga0265462_113353552 | 3300030738 | Soil | MHLAHRQGNSLLRFLPRENAHFRFWCEHRGLHRDGVWVRRDIIGQDQD |
| Ga0307497_102975601 | 3300031226 | Soil | MYLAHRQGNPFLGLLPREYAHFGLRREHRGLHGDGVRMRRDIIRQDQQGRLA |
| Ga0302324_1001679071 | 3300031236 | Palsa | MENPLPLSRPMRLQEGTYLTHRQGNPFLGLLPRINAYFGFRGEHRALHGNRVRMRRNIVRQNQYGRLTM |
| Ga0170818_1055135323 | 3300031474 | Forest Soil | MRPEEGADLADRQRNPLLGLLPRKQAHFGLRRQHRGLHGDGVGMRRDVIRQDED |
| Ga0318541_103175871 | 3300031545 | Soil | MRPEEGMNLAHSEGNPLLGLLPRKHAYFRVRREHRGLHGD |
| Ga0302137_12912491 | 3300031588 | Marine | MRAEEGSNLSYRQWNPLWRFLPREHADFALWREHRGLHGDS |
| Ga0310686_1069255361 | 3300031708 | Soil | MCPQEGTYLAYCQGNPFLRLFPRKDAHFGLWREHRGFHGDSVRMCRD |
| Ga0307474_114822921 | 3300031718 | Hardwood Forest Soil | VVGAEEGMDLAHGQRDAVLGLLPGEHADFGLGGEHRGLHGYDVGMRGDVIGQD |
| Ga0307469_104377572 | 3300031720 | Hardwood Forest Soil | MDLAHRQRNPLLGLLPREHAHFGLWREHRGLHGHGVGMRRDIIRQDQYGC |
| Ga0307468_1008793601 | 3300031740 | Hardwood Forest Soil | MHLADRQGNALLGLLPGEHADFGVWREHGGFHGHLVRM |
| Ga0318547_105265091 | 3300031781 | Soil | MRPQEGTYLADRQGNPFFGLLPREHAHFGLRREHRGFHGDGVRMSRDIIRQDQNGR |
| Ga0318547_109136691 | 3300031781 | Soil | MRPEEGAYLAHRQGNSFLRLLPRKHAHFGIGREHRGFHGDGVWMRRNIIRQDEYG |
| Ga0307473_114858631 | 3300031820 | Hardwood Forest Soil | MNLAHRQGNPFLGLLPREYAHFGVWREHRSLHGDGVRMRRDIIRQDQH |
| Ga0310904_103183551 | 3300031854 | Soil | MRPEEGTYLAHRQGDPFFGFFPWEHAHFGLRREHRGLHGDGVRMRRNIVWK |
| Ga0310892_113300641 | 3300031858 | Soil | MYLAHRQRNPLLGLLPREYAHFGLRREHRGLHGDSIR |
| Ga0306925_108917071 | 3300031890 | Soil | MRPQEGTYLADRQGNPFFGLLPREHAHFGLRREHRGFHGDGVRMSRDIIRQDQNG |
| Ga0306925_113491232 | 3300031890 | Soil | MRPEEGAYLAHRQGNSFLRLLPRKHAHFGIGREHRGFHGDGVWMRRNIIR |
| Ga0306921_102343253 | 3300031912 | Soil | MRPKEGTYLTHCKGNPLLRLLPREDAHFGVRREHRGLHGH |
| Ga0306926_107165292 | 3300031954 | Soil | MRPQEGTYLADRQGNPFFGLLPREHAHFGLRREHRGFHGDGVRMSRDIIRQDQ |
| Ga0318563_104535851 | 3300032009 | Soil | MRPKEGTYLTHCKGNPLLRLLPREDAHFGVRREHRGLHGHGVRMRRDIIR |
| Ga0310890_104508651 | 3300032075 | Soil | MRPEEGTYLAHRQGDPFFGFFPWEHAHFGLRREHRGLHCDGVRMRRNIVWKDQYRRLA |
| Ga0310890_115780891 | 3300032075 | Soil | MRPEEGTYLAHGQGNPFFGFFPREHAHFGFWREHRGLHGDGVRMRRNIVWKDQ |
| Ga0310889_103852451 | 3300032179 | Soil | MRPEEGTYLPNCQGNPFGWLLPRKHAHFGLRREHRGLHGDSVRMR |
| Ga0307471_1013488191 | 3300032180 | Hardwood Forest Soil | MRPEERAYLAHRQGNPLLGLLPREHAHFGIWREHG |
| Ga0310812_101878162 | 3300032421 | Soil | MRLQEGMDLAHRQGNPLFGLFPGEDAHFGFRRKHRTLHGYGVWMSRDIIRQDQYR |
| Ga0310914_113160012 | 3300033289 | Soil | MRPEEGAYLAHRQGNSFLRLLPRKHAHFGIGREHRGFHGDGVWMRRNIIRQDEYGRLT |
| Ga0364926_118554_3_140 | 3300033812 | Sediment | MRPKERTYLAHGQGNPLLGLLPWVDAHFGLRREHRALHGDDVRMRR |
| Ga0364929_0030792_2_148 | 3300034149 | Sediment | MRSQEGTYLAHCQGNPLLWLFPWEHAHFGLRREHRGLHGDGVWMRRDII |
| Ga0364929_0211124_2_133 | 3300034149 | Sediment | MRSEEGTYLAHRQGNPLLWLFPWEHAHFGLRREHRGLHGDGVWM |
| Ga0364934_0327805_2_166 | 3300034178 | Sediment | MCSKEGTYLAHRQGNPLFGLLPREHAYFPLWREHRGLHGDGVRMRRDIIRQDQYG |
| ⦗Top⦘ |